DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. Structure (London, England : 1993) 2012 imex curation Samborska B., Kimber MS. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Samborska B., Kimber MS. DIP original experiment: DIP-250491X Structure (London, England : 1993) 2012 IMEx A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. Structure (London, England : 1993) 2012 imex curation Samborska B., Kimber MS. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Samborska B., Kimber MS. DIP original experiment: DIP-250493X Structure (London, England : 1993) 2012 IMEx A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. Structure (London, England : 1993) 2012 imex curation Samborska B., Kimber MS. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Samborska B., Kimber MS. DIP original experiment: DIP-250492X Structure (London, England : 1993) 2012 IMEx A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. Structure (London, England : 1993) 2012 imex curation Samborska B., Kimber MS. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Samborska B., Kimber MS. DIP original experiment: DIP-250494X Structure (London, England : 1993) 2012 IMEx A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. Structure (London, England : 1993) 2012 imex curation Samborska B., Kimber MS. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Samborska B., Kimber MS. DIP original experiment: DIP-250488X Structure (London, England : 1993) 2012 IMEx A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. Structure (London, England : 1993) 2012 imex curation Samborska B., Kimber MS. Only protein-protein interactions ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Samborska B., Kimber MS. DIP original experiment: DIP-250487X Structure (London, England : 1993) 2012 IMEx A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. Structure (London, England : 1993) 2012 imex curation Samborska B., Kimber MS. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Samborska B., Kimber MS. DIP original experiment: DIP-250496X Structure (London, England : 1993) 2012 IMEx A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. Structure (London, England : 1993) 2012 imex curation Samborska B., Kimber MS. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Samborska B., Kimber MS. DIP original experiment: DIP-250495X Structure (London, England : 1993) 2012 IMEx A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. Structure (London, England : 1993) 2012 imex curation Samborska B., Kimber MS. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Samborska B., Kimber MS. DIP original experiment: DIP-250490X Structure (London, England : 1993) 2012 IMEx A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. Structure (London, England : 1993) 2012 imex curation Samborska B., Kimber MS. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Samborska B., Kimber MS. DIP original experiment: DIP-250498X Structure (London, England : 1993) 2012 IMEx A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. Structure (London, England : 1993) 2012 imex curation Samborska B., Kimber MS. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Samborska B., Kimber MS. DIP original experiment: DIP-250497X Structure (London, England : 1993) 2012 IMEx A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. Structure (London, England : 1993) 2012 imex curation Samborska B., Kimber MS. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Samborska B., Kimber MS. DIP original experiment: DIP-250489X Structure (London, England : 1993) 2012 IMEx A dodecameric CcmK2 structure suggests β-carboxysomal shell facets have a double-layered organization. q8dii9_theeb ccmK4 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MGNVEGGMAMAVEAVGMVQVLGYPAALAVADTLVKAAQVTLVSCEGIGAGYWTVVIRGEVADVKAAVGAARSLSGQAVISYQIIARPDGNLEQVLPIGVPHQPPEDFLL DIP protein Q8DII9 original sequence version: 36 ccmk1_theeb Carboxysome shell protein CcmK1 ccmK1 Carbon dioxide-concentrating mechanism protein CcmK1 tll0946 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MAIAVGMIETLGFPAVVEAADAMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVAAGVENVKRVNGGQVLSTHIIARPHENLEYVLPIRYTEAVEQFRESVSGIRPMGRP DIP protein Q8DKB3 original sequence version: 43 ccmk2_theeb Carboxysome shell protein CcmK2 ccmK2 Carbon dioxide-concentrating mechanism protein CcmK2 tll0947 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MPIAVGMIETRGFPAVVEAADAMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVAAGVDSAKRVNGGEVLSTHIIARPHENLEYVLPIRYTEAVEQFRN DIP protein Q8DKB2 original sequence version: 43 ccmk2-1 6 15 unspecified role unspecified role unspecified role unspecified role Region 1-91 Region 1-91 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ccmk2-ccmk1-1 3 14 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept 5-IAF-label 5-IAF-label fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role fluorescence donor fluorescence donor IAEDANS-label IAEDANS-label iaedans label iaedans label IAEDANS 1,5-IAEDANS (5((((2-iodoacetyl)amino)ethyl)amino)-naphthalene-1-sulfonic acid) IAEDANS 1,5-IAEDANS certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ccmk4-1 4 13 unspecified role unspecified role fluorescence donor fluorescence donor IAEDANS-label IAEDANS-label iaedans label iaedans label IAEDANS 1,5-IAEDANS (5((((2-iodoacetyl)amino)ethyl)amino)-naphthalene-1-sulfonic acid) IAEDANS 1,5-IAEDANS certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept 5-IAF-label 5-IAF-label fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ccmk1-1 7 14 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept 5-IAF-label 5-IAF-label fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role fluorescence donor fluorescence donor IAEDANS-label IAEDANS-label iaedans label iaedans label IAEDANS 1,5-IAEDANS (5((((2-iodoacetyl)amino)ethyl)amino)-naphthalene-1-sulfonic acid) IAEDANS 1,5-IAEDANS certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ccmk2-2 10 15 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept 5-IAF-label 5-IAF-label fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain Q8DKB2:p.Glu95Ala E95A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E95A'. Wed May 02 14:44:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu95ala' Tue Jun 30 18:28:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu95Ala' ecolx Escherichia coli 15 unspecified role unspecified role fluorescence donor fluorescence donor IAEDANS-label IAEDANS-label iaedans label iaedans label IAEDANS 1,5-IAEDANS (5((((2-iodoacetyl)amino)ethyl)amino)-naphthalene-1-sulfonic acid) IAEDANS 1,5-IAEDANS certain certain sequence position certain certain certain sequence position certain Q8DKB2:p.Glu95Ala E95A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E95A'. Wed May 02 20:13:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu95ala' Tue Jun 30 15:55:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu95Ala' ecolx Escherichia coli direct interaction direct interaction ccmk2-3 5 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ccmk2-4 1 15 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept 5-IAF-label 5-IAF-label fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role fluorescence donor fluorescence donor IAEDANS-label IAEDANS-label iaedans label iaedans label IAEDANS 1,5-IAEDANS (5((((2-iodoacetyl)amino)ethyl)amino)-naphthalene-1-sulfonic acid) IAEDANS 1,5-IAEDANS certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ccmk1-2 12 14 unspecified role unspecified role unspecified role unspecified role Region 1-102 Region 1-102 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ccmk2-ccmk4-1 2 13 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept 5-IAF-label 5-IAF-label fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role fluorescence donor fluorescence donor IAEDANS-label IAEDANS-label iaedans label iaedans label IAEDANS 1,5-IAEDANS (5((((2-iodoacetyl)amino)ethyl)amino)-naphthalene-1-sulfonic acid) IAEDANS 1,5-IAEDANS certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ccmk1-ccmk2-1 8 14 unspecified role unspecified role fluorescence donor fluorescence donor IAEDANS-label IAEDANS-label iaedans label iaedans label IAEDANS 1,5-IAEDANS (5((((2-iodoacetyl)amino)ethyl)amino)-naphthalene-1-sulfonic acid) IAEDANS 1,5-IAEDANS certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept 5-IAF-label 5-IAF-label fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ccmk1-ccmk4-1 11 13 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept 5-IAF-label 5-IAF-label fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role fluorescence donor fluorescence donor IAEDANS-label IAEDANS-label iaedans label iaedans label IAEDANS 1,5-IAEDANS (5((((2-iodoacetyl)amino)ethyl)amino)-naphthalene-1-sulfonic acid) IAEDANS 1,5-IAEDANS certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ccmk2-5 9 15 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept 5-IAF-label 5-IAF-label fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain Q8DKB2:p.Glu95Ala E95A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E95A'. Wed May 02 20:28:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu95ala' Tue Jun 30 20:21:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu95Ala' ecolx Escherichia coli 15 unspecified role unspecified role fluorescence donor fluorescence donor IAEDANS-label IAEDANS-label iaedans label iaedans label IAEDANS 1,5-IAEDANS (5((((2-iodoacetyl)amino)ethyl)amino)-naphthalene-1-sulfonic acid) IAEDANS 1,5-IAEDANS certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction