DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu ER network formation requires a balance of the dynamin-like GTPase Sey1p and the Lunapark family member Lnp1p. ER network formation requires a balance of the dynamin-like GTPase Sey1p and the Lunapark family member Lnp1p. Nature cell biology 2012 imex curation Chen S., Novick P., Ferro-Novick S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen S., Novick P., Ferro-Novick S. DIP original experiment: DIP-268080X Nature cell biology 2012 IMEx ER network formation requires a balance of the dynamin-like GTPase Sey1p and the Lunapark family member Lnp1p. ER network formation requires a balance of the dynamin-like GTPase Sey1p and the Lunapark family member Lnp1p. ER network formation requires a balance of the dynamin-like GTPase Sey1p and the Lunapark family member Lnp1p. Nature cell biology 2012 imex curation Chen S., Novick P., Ferro-Novick S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen S., Novick P., Ferro-Novick S. DIP original experiment: DIP-268078X Nature cell biology 2012 IMEx ER network formation requires a balance of the dynamin-like GTPase Sey1p and the Lunapark family member Lnp1p. ER network formation requires a balance of the dynamin-like GTPase Sey1p and the Lunapark family member Lnp1p. ER network formation requires a balance of the dynamin-like GTPase Sey1p and the Lunapark family member Lnp1p. Nature cell biology 2012 imex curation Chen S., Novick P., Ferro-Novick S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen S., Novick P., Ferro-Novick S. DIP original experiment: DIP-268079X Nature cell biology 2012 IMEx ER network formation requires a balance of the dynamin-like GTPase Sey1p and the Lunapark family member Lnp1p. ER network formation requires a balance of the dynamin-like GTPase Sey1p and the Lunapark family member Lnp1p. ER network formation requires a balance of the dynamin-like GTPase Sey1p and the Lunapark family member Lnp1p. Nature cell biology 2012 imex curation Chen S., Novick P., Ferro-Novick S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen S., Novick P., Ferro-Novick S. DIP original experiment: DIP-268082X Nature cell biology 2012 IMEx ER network formation requires a balance of the dynamin-like GTPase Sey1p and the Lunapark family member Lnp1p. ER network formation requires a balance of the dynamin-like GTPase Sey1p and the Lunapark family member Lnp1p. ER network formation requires a balance of the dynamin-like GTPase Sey1p and the Lunapark family member Lnp1p. Nature cell biology 2012 imex curation Chen S., Novick P., Ferro-Novick S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen S., Novick P., Ferro-Novick S. DIP original experiment: DIP-268081X Nature cell biology 2012 IMEx ER network formation requires a balance of the dynamin-like GTPase Sey1p and the Lunapark family member Lnp1p. sey1_yeast Protein SEY1 SEY1 YOR165W Synthetic enhancer of YOP1 protein O3590 protein protein yeast Saccharomyces cerevisiae Baker's yeast MADRPAIQLIDEEKEFHQSALQYFQQCIGNRDVGLDYHVISVFGSQSSGKSTLLNVLFNTNFDTMDAQVKRQQTTKGIWLAHTKQVNTTIEIDNDRPDIFVLDVEGSDGSERGEDQDFERKAALFAIAVSEVLIVNMWEQQIGLYQGNNMALLKTVFEVNLSLFGKNDNDHKVLLLFVIRDHVGVTPLSSLSDSVTRELEKIWTELSKPAGCEGSSLYDYFDLKFVGLAHKLLQEDKFTQDVKKLGDSFVMKGTENYYFKPQYHHRLPLDGWTMYAENCWDQIERNKDLDLPTQQILVARFKTEEISNEALEEFISKYDESIAPLKGNLGSLTSQLVKLKEECLTKYDEQASRYARNVYMEKREALNTKLNSHISGTINEFLESLMEKLWDDLKLEVSSRDKATTSFVESVAAGKSKIEKEFNESMETFKKLGLLISNEEITCKFSDDIEERIKQLRDAELKAKIGRIKKNLVPELKDHVIHLLSHPSKKVWDDIMNDFESTIKDNISAYQVEKDKYDFKIGLSESENAKIYKNIRILAWRTLDTTVHDYLKIDTIVSILRDRFEDVFRYDAEGSPRLWKTEEEIDGAFRVAKEHALEVFEVLSLAVTSDNVEIIPDVPMAEEESGEDNEIYRDNEGVFHSRRFAHILTELQKENVLDQFRRQINITVLDSKRSIITTRTHIPPWIYVLLAVLGWNEFVAVIRNPLFVTLTLILGATFFVIHKFGLWGPVVNVVQSAVGETRTAIKDKLRQFVVEDHEVKESFEMKDFSKNEQKEK DEC0C9EC3AB172DF DEC0C9EC3AB172DF yop1_yeast Protein YOP1 YOP1 YIP2 YPR028W YP9367.08 YIP1 partner protein 1 YPT-interacting protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEYASSIHSQMKQFDTKYSGNRILQQLENKTNLPKSYLVAGLGFAYLLLIFINVGGVGEILSNFAGFVLPAYLSLVALKTPTSTDDTQLLTYWIVFSFLSVIEFWSKAILYLIPFYWFLKTVFLIYIALPQTGGARMIYQKIVAPLTDRYILRDVSKTEKDEIRASVNEASKATGASVH 6F1073444B653CCF 6F1073444B653CCF rtn1_yeast Reticulon-like protein 1 RTN1 YDR233C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSASAQHSQAQQQQQQKSCNCDLLLWRNPVQTGKYFGGSLLALLILKKVNLITFFLKVAYTILFTTGSIEFVSKLFLGQGLITKYGPKECPNIAGFIKPHIDEALKQLPVFQAHIRKTVFAQVPKHTFKTAVALFLLHKFFSWFSIWTIVFVADIFTFTLPVIYHSYKHEIDATVAQGVEISKQKTQEFSQMACEKTKPYLDKVESKLGPISNLVKSKTAPVSSTAGPQTASTSKLAADVPLEPESKAYTSSAQVMPEVPQHEPSTTQEFNVDELSNELKKSTKNLQNELEKNNA 245575E65D3C2193 245575E65D3C2193 lnp_yeast Endoplasmic reticulum junction formation protein lunapark LNP1 ER junction formation factor lunapark YHR192W protein protein yeast Saccharomyces cerevisiae Baker's yeast MFSALGKWVRGSRNDKDFVTKYTADLSQITSQIHQLDVALKKSQSILSQWQSNLTFYGIALTVLALSYTYWEYHGYRPYLVVTALLCIGSLILFKWALTKLYAFYNNNRLRKLAKLRAIHQKKLEKLKEETHYNATSSIIQRFSSGEDQNDDAMVLLDDELNAKYQELNNLKTELEKFKKESHVKGLKKEDSDAWFDKIISVLAGGNELDSTSSLSPFKKIICPQCHWKSNCYRLASKPIIFICPHCNHKIDEVKEREDAIEAKQPAQPSQSEKEKTK D896557EEE805C89 lnp1p-yop1p-1 1 7 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association lnp1p-rtn1p-1 2 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rtn1p-yop1p-1 4 8 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sey1p-rtn1p-1 5 6 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association lnp1p-sey1p-1 3 6 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association