IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Crystal structure of human RANKL complexed with its decoy receptor osteoprotegerin. Crystal structure of human RANKL complexed with its decoy receptor osteoprotegerin. Journal of immunology (Baltimore, Md. : 1950) 2012 imex curation Luan X., Lu Q., Jiang Y., Zhang S., Wang Q., Yuan H., Zhao W., Wang J., Wang X. xinquanwang@mail.tsinghua.edu.cn 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Luan X., Lu Q., Jiang Y., Zhang S., Wang Q., Yuan H., Zhao W., Wang J., Wang X. xinquanwang@mail.tsinghua.edu.cn Accepted 2017-AUG-04 AT 08:13 BST AT 08:13 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2012 imex curation Crystal structure of human RANKL complexed with its decoy receptor osteoprotegerin. Crystal structure of human RANKL complexed with its decoy receptor osteoprotegerin. Journal of immunology (Baltimore, Md. : 1950) 2012 imex curation Luan X., Lu Q., Jiang Y., Zhang S., Wang Q., Yuan H., Zhao W., Wang J., Wang X. xinquanwang@mail.tsinghua.edu.cn 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Luan X., Lu Q., Jiang Y., Zhang S., Wang Q., Yuan H., Zhao W., Wang J., Wang X. xinquanwang@mail.tsinghua.edu.cn Accepted 2017-AUG-04 AT 08:13 BST AT 08:13 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2012 imex curation Crystal structure of human RANKL complexed with its decoy receptor osteoprotegerin. Crystal structure of human RANKL complexed with its decoy receptor osteoprotegerin. Journal of immunology (Baltimore, Md. : 1950) 2012 imex curation Luan X., Lu Q., Jiang Y., Zhang S., Wang Q., Yuan H., Zhao W., Wang J., Wang X. xinquanwang@mail.tsinghua.edu.cn 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Luan X., Lu Q., Jiang Y., Zhang S., Wang Q., Yuan H., Zhao W., Wang J., Wang X. xinquanwang@mail.tsinghua.edu.cn Accepted 2017-AUG-04 AT 08:13 BST AT 08:13 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2012 imex curation tr11b_human Tumor necrosis factor receptor superfamily member 11B OCIF OPG TNFRSF11B Osteoclastogenesis inhibitory factor Osteoprotegerin protein protein human Homo sapiens Human MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL 2A23AC07BFA1E2DE tnr11_human Tumor necrosis factor receptor superfamily member 11A Receptor activator of NF-KB Osteoclast differentiation factor receptor TNFRSF11A RANK protein protein human Homo sapiens Human MAPRARRRRPLFALLLLCALLARLQVALQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLPGLIILLLFASVALVAAIIFGVCYRKKGKALTANLWHWINEACGRLSGDKESSGDSCVSTHTANFGQQGACEGVLLLTLEEKTFPEDMCYPDQGGVCQGTCVGGGPYAQGEDARMLSLVSKTEIEEDSFRQMPTEDEYMDRPSQPTDQLLFLTEPGSKSTPPFSEPLEVGENDSLSQCFTGTQSTVGSESCNCTEPLCRTDWTPMSSENYLQKEVDSGHCPHWAASPSPNWADVCTGCRNPPGEDCEPLVGSPKRGPLPQCAYGMGLPPEEEASRTEARDQPEDGADGRLPSSARAGAGSGSSPGGQSPASGNVTGNSNSTFISSGQVMNFKGDIIVVYVSQTSQEGAAAAAEPMGRPVQEETLARRDSFAGNGPRFPDPCGGPEGLREPEKASRPVQEQGGAKA E3DE9A7A08196F81 tnf11_human Tumor necrosis factor ligand superfamily member 11 TNFSF11 OPGL Osteoclast differentiation factor Osteoprotegerin ligand RANKL Receptor activator of nuclear factor kappa-B ligand TNF-related activation-induced cytokine TRANCE protein protein human Homo sapiens Human MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQVVCSVALFFYFRAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID mint homomint 766176446348097F tnfrsf11b-tnfsf11-1 2 6 unspecified role unspecified role neutral component neutral component partial_ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component cysteine-rich-domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 9 11 direct interaction direct interaction Table 1 The OPG-CRD (O00300) in Methods section is clearly stated to have been expressed in Hi5 cells AFTER Sf9 cells (pdbe states Sf9). The RANKL C-terminal His tag is stated (along with NusA tag) to have been removed-but still being present in PDB entry. 2.7A Rwork = 0.202 Rfree = 0.251 In this article, we report the 2.7-Å crystal structure of human RANKL trimer in complex with the N-terminal fragment of human OPG containing four cysteine-rich TNFR homologous domains (OPG-CRD). tnfrsf11b-tnfsf11-2 3 6 unspecified role unspecified role bait bait partial_ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey cysteine-rich-domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range O00300:p.Asp78_Glu79delinsAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain DE AA Thu Aug 17 12:31:02 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'asp78ala,glu79ala' Wed May 02 15:25:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp_glu78-79ala_ala' Tue Jun 30 17:38:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp78_Glu79delinsAlaAla' O00300:p.Glu116Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A Wed May 02 17:38:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu116ala' Tue Jun 30 17:56:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu116Ala' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 15 17 direct interaction direct interaction Figure 4C tnfsf11-tnfrsf11b-1 1 6 unspecified role unspecified role bait bait purified purified partial_ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O14788:p.Arg223Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 18:55:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg223ala' Tue Jun 30 17:47:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg223Ala' O14788:p.Lys257Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:31:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys257ala' Tue Jun 30 17:47:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys257Ala' O14788:p.Tyr241Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 16:14:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr241ala' Tue Jun 30 16:40:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr241Ala' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey purified purified cysteine-rich-domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 29 23 direct interaction direct interaction Figure 5C -LHS tnfsf11-tnfrsf11b-2 1 6 unspecified role unspecified role bait bait purified purified partial_ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O14788:p.Arg223Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 17:59:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg223ala' Tue Jun 30 19:35:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg223Ala' O14788:p.Lys257Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:07:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys257ala' Tue Jun 30 18:02:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys257Ala' O14788:p.Tyr241Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 19:05:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr241ala' Tue Jun 30 16:03:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr241Ala' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 39 33 direct interaction direct interaction Figure 5C -RHS