DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Chitin-induced dimerization activates a plant immune receptor. Chitin-induced dimerization activates a plant immune receptor. Science (New York, N.Y.) 2012 imex curation Liu T., Liu Z., Song C., Hu Y., Han Z., She J., Fan F., Wang J., Jin C., Chang J., Zhou JM., Chai J. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Liu T., Liu Z., Song C., Hu Y., Han Z., She J., Fan F., Wang J., Jin C., Chang J., Zhou JM., Chai J. DIP original experiment: DIP-268271X Science (New York, N.Y.) 2012 IMEx Chitin-induced dimerization activates a plant immune receptor. Chitin-induced dimerization activates a plant immune receptor. Chitin-induced dimerization activates a plant immune receptor. Science (New York, N.Y.) 2012 imex curation Liu T., Liu Z., Song C., Hu Y., Han Z., She J., Fan F., Wang J., Jin C., Chang J., Zhou JM., Chai J. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu T., Liu Z., Song C., Hu Y., Han Z., She J., Fan F., Wang J., Jin C., Chang J., Zhou JM., Chai J. DIP original experiment: DIP-268272X Science (New York, N.Y.) 2012 IMEx Chitin-induced dimerization activates a plant immune receptor. Chitin-induced dimerization activates a plant immune receptor. Chitin-induced dimerization activates a plant immune receptor. Science (New York, N.Y.) 2012 imex curation Liu T., Liu Z., Song C., Hu Y., Han Z., She J., Fan F., Wang J., Jin C., Chang J., Zhou JM., Chai J. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Liu T., Liu Z., Song C., Hu Y., Han Z., She J., Fan F., Wang J., Jin C., Chang J., Zhou JM., Chai J. DIP original experiment: DIP-268270X Science (New York, N.Y.) 2012 IMEx Chitin-induced dimerization activates a plant immune receptor. Chitin-induced dimerization activates a plant immune receptor. Chitin-induced dimerization activates a plant immune receptor. Science (New York, N.Y.) 2012 imex curation Liu T., Liu Z., Song C., Hu Y., Han Z., She J., Fan F., Wang J., Jin C., Chang J., Zhou JM., Chai J. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Liu T., Liu Z., Song C., Hu Y., Han Z., She J., Fan F., Wang J., Jin C., Chang J., Zhou JM., Chai J. DIP original experiment: DIP-268269X Science (New York, N.Y.) 2012 IMEx Chitin-induced dimerization activates a plant immune receptor. cerk1_arath Chitin elicitor receptor kinase 1 CERK1 LYK1 LysM domain receptor-like kinase 1 RLK1 MIL23.20 At3g21630 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKLKISLIAPILLLFSFFFAVESKCRTSCPLALASYYLENGTTLSVINQNLNSSIAPYDQINFDPILRYNSNIKDKDRIQMGSRVLVPFPCECQPGDFLGHNFSYSVRQEDTYERVAISNYANLTTMESLQARNPFPATNIPLSATLNVLVNCSCGDESVSKDFGLFVTYPLRPEDSLSSIARSSGVSADILQRYNPGVNFNSGNGIVYVPGRDPNGAFPPFKSSKQDGVGAGVIAGIVIGVIVALLLILFIVYYAYRKNKSKGDSFSSSIPLSTKADHASSTSLQSGGLGGAGVSPGIAAISVDKSVEFSLEELAKATDNFNLSFKIGQGGFGAVYYAELRGEKAAIKKMDMEASKQFLAELKVLTRVHHVNLVRLIGYCVEGSLFLVYEYVENGNLGQHLHGSGREPLPWTKRVQIALDSARGLEYIHEHTVPVYVHRDIKSANILIDQKFRAKVADFGLTKLTEVGGSATRGAMGTFGYMAPETVYGEVSAKVDVYAFGVVLYELISAKGAVVKMTEAVGEFRGLVGVFEESFKETDKEEALRKIIDPRLGDSYPFDSVYKMAELGKACTQENAQLRPSMRYIVVALSTLFSSTGNWDVGNFQNEDLVSLMSGR CF5019DB428CFE1E DIP protein A8R7E6 original sequence version: 79 The protein could not be merged with EBI-12873142 because of some conflicts with the protein sequence (features which cannot be shifted). cerk1-1 4 5 unspecified role unspecified role unspecified role unspecified role Region 25-230 Region 25-230 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction cerk1-cerk1-1 2 5 unspecified role unspecified role prey prey Region 25-230 Region 25-230 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range [EBI-13767040]C-terminal positions must always be equal to the length of the protein sequence. Actual positions : 0-0, sequence length 617 [EBI-13767040]0-0 ala138his A138H mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain A H This feature has been corrected as a result of our quality control procedures. The original label was 'A138H'. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 5 unspecified role unspecified role bait bait Region 25-230 Region 25-230 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range [EBI-13767032]C-terminal positions must always be equal to the length of the protein sequence. Actual positions : 0-0, sequence length 617 [EBI-13767032]0-0 ala138his A138H mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain A H This feature has been corrected as a result of our quality control procedures. The original label was 'A138H'. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association cerk1-2 3 5 unspecified role unspecified role unspecified role unspecified role Region 25-230 Region 25-230 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction cerk1-cerk1-2 1 5 unspecified role unspecified role prey prey Region 25-230 Region 25-230 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range [EBI-13767085]C-terminal positions must always be equal to the length of the protein sequence. Actual positions : 0-0, sequence length 617 [EBI-13767085]0-0 ala138his A138H mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain A H This feature has been corrected as a result of our quality control procedures. The original label was 'A138H'. spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 5 unspecified role unspecified role bait bait Region 25-230 Region 25-230 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range [EBI-13767077]C-terminal positions must always be equal to the length of the protein sequence. Actual positions : 0-0, sequence length 617 [EBI-13767077]0-0 ala138his A138H mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain A H This feature has been corrected as a result of our quality control procedures. The original label was 'A138H'. spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction