DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Structure (London, England : 1993) 2012 imex curation Pobbati AV., Chan SW., Lee I., Song H., Hong W. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Pobbati AV., Chan SW., Lee I., Song H., Hong W. DIP original experiment: DIP-250466X Structure (London, England : 1993) 2012 IMEx Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Structure (London, England : 1993) 2012 imex curation Pobbati AV., Chan SW., Lee I., Song H., Hong W. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pobbati AV., Chan SW., Lee I., Song H., Hong W. DIP original experiment: DIP-250463X Structure (London, England : 1993) 2012 IMEx Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Structure (London, England : 1993) 2012 imex curation Pobbati AV., Chan SW., Lee I., Song H., Hong W. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pobbati AV., Chan SW., Lee I., Song H., Hong W. DIP original experiment: DIP-250465X Structure (London, England : 1993) 2012 IMEx Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Structure (London, England : 1993) 2012 imex curation Pobbati AV., Chan SW., Lee I., Song H., Hong W. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pobbati AV., Chan SW., Lee I., Song H., Hong W. DIP original experiment: DIP-250464X Structure (London, England : 1993) 2012 IMEx Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Structure (London, England : 1993) 2012 imex curation Pobbati AV., Chan SW., Lee I., Song H., Hong W. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pobbati AV., Chan SW., Lee I., Song H., Hong W. DIP original experiment: DIP-250462X Structure (London, England : 1993) 2012 IMEx Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. vgll1_mouse Transcription cofactor vestigial-like protein 1 Vgll1 Vestigial-related factor protein protein mouse Mus musculus Mouse MEEMKKNGVWIPESSQKPVKTEWNAGSVIFTYFEGDINSMVDEHFSRALRNLKRPHKCSSSSHSDNLTLKNGVNKTRTDTSHTDRERKVESSQTENSGELKDVPVEEKGTNKSMPPNQRHLSSWTIAQPAASPENGARSSSLDEYGLKAMDQHSLSMPKTPSALPLEPWHFSSLARPGFIAPAYFPVFPDRHLTPEVYRVFPDRHLTPEVYHVFPDRHLTPEVYPDGRCGPLQHLVQQDRYQNHPLEPAARENCSPAKIAGSTGSLMNLPPYPVHYKKKICARGAASASLDDERSPSPKRRRDAYYY DIP protein Q99NC0 original sequence version: 60 yap1_human Transcriptional coactivator YAP1 YAP1 YAP65 Protein yorkie homolog Yes-associated protein YAP65 homolog protein protein human Homo sapiens Human MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL DIP protein P46937 original sequence version: 143 DIP protein P46937 original sequence version: 98 DIP protein P46937-1 original sequence version: 110 DIP protein P46937 original sequence version: 149 DIP protein P46937 original sequence version: 153 DIP protein P46937 original sequence version: 157 DIP protein P46937 original sequence version: 160 DIP protein P46937 original sequence version: 122 DIP protein P46937 original sequence version: 124 6145F7049ED338AE q62296-1 Transcriptional enhancer factor TEF-3 Tead4 Tcf13r1 Tef3 Tefr1 TEFR1A ETFR-2A ETF-related factor 2 TEA domain family member 4 TEF-1-related factor 1 TEF-1-related factor FR-19 protein protein mouse Mus musculus Mouse MTSNEWSSPDSPEGSSISGGSQALDKPIDNDAEGVWSPEIERSFQEALAIYPPCGRRKIILTEEGKMYGRNELIARHIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKNKALQSMAAMSSAQIVSATAFHSKMALARGPGYPAISGFWQGALPGQPGTSHDVKPFSQNTYPVQPPLPLPGFESPAGPTPSPSAPLAPPWQGRSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE DIP protein Q62296-1 original sequence version: 102 tead4-vgll1-3 4 6 unspecified role unspecified role prey prey Q99NC0:p.[His44Ala;Phe45Ala] H44A/F45A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain H A This feature has been corrected as a result of our quality control procedures. The original label was 'H44A/F45A'. Wed May 02 19:20:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his44ala,phe45ala' Tue Jun 30 18:43:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His44Ala;Phe45Ala]' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association tead4-yap1-4 1 7 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association tead4-vgll1-4 5 6 unspecified role unspecified role unspecified role unspecified role Region 20-56 Region 20-56 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role C-terminal Region 210-427 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tead4-vgll1-5 2 6 unspecified role unspecified role unspecified role unspecified role Region 20-56 Region 20-56 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role C-terminal Region 210-427 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tead4-vgll1-6 3 6 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association