DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Nature cell biology 2012 imex curation Varma D., Chandrasekaran S., Sundin LJ., Reidy KT., Wan X., Chasse DA., Nevis KR., DeLuca JG., Salmon ED., Cook JG. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Varma D., Chandrasekaran S., Sundin LJ., Reidy KT., Wan X., Chasse DA., Nevis KR., DeLuca JG., Salmon ED., Cook JG. DIP original experiment: DIP-268070X Nature cell biology 2012 IMEx Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Nature cell biology 2012 imex curation Varma D., Chandrasekaran S., Sundin LJ., Reidy KT., Wan X., Chasse DA., Nevis KR., DeLuca JG., Salmon ED., Cook JG. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Varma D., Chandrasekaran S., Sundin LJ., Reidy KT., Wan X., Chasse DA., Nevis KR., DeLuca JG., Salmon ED., Cook JG. DIP original experiment: DIP-268068X Nature cell biology 2012 IMEx Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Nature cell biology 2012 imex curation Varma D., Chandrasekaran S., Sundin LJ., Reidy KT., Wan X., Chasse DA., Nevis KR., DeLuca JG., Salmon ED., Cook JG. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Varma D., Chandrasekaran S., Sundin LJ., Reidy KT., Wan X., Chasse DA., Nevis KR., DeLuca JG., Salmon ED., Cook JG. DIP original experiment: DIP-268069X Nature cell biology 2012 IMEx Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Nature cell biology 2012 imex curation Varma D., Chandrasekaran S., Sundin LJ., Reidy KT., Wan X., Chasse DA., Nevis KR., DeLuca JG., Salmon ED., Cook JG. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Varma D., Chandrasekaran S., Sundin LJ., Reidy KT., Wan X., Chasse DA., Nevis KR., DeLuca JG., Salmon ED., Cook JG. DIP original experiment: DIP-268065X Nature cell biology 2012 IMEx Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Nature cell biology 2012 imex curation Varma D., Chandrasekaran S., Sundin LJ., Reidy KT., Wan X., Chasse DA., Nevis KR., DeLuca JG., Salmon ED., Cook JG. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Varma D., Chandrasekaran S., Sundin LJ., Reidy KT., Wan X., Chasse DA., Nevis KR., DeLuca JG., Salmon ED., Cook JG. DIP original experiment: DIP-268067X Nature cell biology 2012 IMEx Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Nature cell biology 2012 imex curation Varma D., Chandrasekaran S., Sundin LJ., Reidy KT., Wan X., Chasse DA., Nevis KR., DeLuca JG., Salmon ED., Cook JG. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Varma D., Chandrasekaran S., Sundin LJ., Reidy KT., Wan X., Chasse DA., Nevis KR., DeLuca JG., Salmon ED., Cook JG. DIP original experiment: DIP-268064X Nature cell biology 2012 IMEx Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Nature cell biology 2012 imex curation Varma D., Chandrasekaran S., Sundin LJ., Reidy KT., Wan X., Chasse DA., Nevis KR., DeLuca JG., Salmon ED., Cook JG. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Varma D., Chandrasekaran S., Sundin LJ., Reidy KT., Wan X., Chasse DA., Nevis KR., DeLuca JG., Salmon ED., Cook JG. DIP original experiment: DIP-268066X Nature cell biology 2012 IMEx Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. Nature cell biology 2012 imex curation Varma D., Chandrasekaran S., Sundin LJ., Reidy KT., Wan X., Chasse DA., Nevis KR., DeLuca JG., Salmon ED., Cook JG. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Varma D., Chandrasekaran S., Sundin LJ., Reidy KT., Wan X., Chasse DA., Nevis KR., DeLuca JG., Salmon ED., Cook JG. DIP original experiment: DIP-268063X Nature cell biology 2012 IMEx Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment. gemi_human Geminin GMNN protein protein human Homo sapiens Human MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI DIP protein O75496 original sequence version: 78 DIP protein O75496 original sequence version: 117 DIP protein O75496 original sequence version: 136 0BABE60F6F5AC252 cdt1_human DNA replication factor Cdt1 Double parked homolog CDT1 protein protein human Homo sapiens Human MEQRRVTDFFARRRPGPPRIAPPKLACRTPSPARPALRAPASATSGSRKRARPPAAPGRDQARPPARRRLRLSVDEVSSPSTPEAPDIPACPSPGQKIKKSTPAAGQPPHLTSAQDQDTISELASCLQRARELGARVRALKASAQDAGESCTPEAEGRPEEPCGEKAPAYQRFHALAQPGLPGLVLPYKYQVLAEMFRSMDTIVGMLHNRSETPTFAKVQRGVQDMMRRRFEECNVGQIKTVYPASYRFRQERSVPTFKDGTRRSDYQLTIEPLLEQEADGAAPQLTASRLLQRRQIFSQKLVEHVKEHHKAFLASLSPAMVVPEDQLTRWHPRFNVDEVPDIEPAALPQPPATEKLTTAQEVLARARNLISPRMEKALSQLALRSAAPSSPGSPRPALPATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQRLERLPELARVLRSVFVSERKPALSMEVACARMVGSCCTIMSPGEMEKHLLLLSELLPDWLSLHRIRTDTYVKLDKAADLAHITARLAHQTRAEEGL DIP protein Q9H211 original sequence version: 69 DIP protein Q9H211 original sequence version: 124 8179D0330C135FB7 ndc80_human Kinetochore protein NDC80 homolog Kinetochore protein Hec1 Kinetochore-associated protein 2 Highly expressed in cancer protein Retinoblastoma-associated protein HEC NDC80 HEC KNTC2 HEC1 protein protein human Homo sapiens Human MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKRTSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSYELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHTAMKESSPLFDDGQPWGEETEDGIMHNKLFLDYTIKCYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENTRLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLARKLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLNAMITESKRSVRTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKHLLESTVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE DIP protein O14777 original sequence version: 126 DIP protein O14777 original sequence version: 132 6A82DA4D8B77ECDC orc6_human Origin recognition complex subunit 6 ORC6 ORC6L protein protein human Homo sapiens Human MGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIKLSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKSYESSLPQTQQVDLDLSRPLFTSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE DIP protein Q9Y5N6 original sequence version: 119 DIP protein Q9Y5N6 original sequence version: 56 DIP protein Q9Y5N6 original sequence version: 130 78840387605F45FE nuf2_human Kinetochore protein Nuf2 NUF2 CDCA1 NUF2R Cell division cycle-associated protein 1 protein protein human Homo sapiens Human METLSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSEVMYPHLMEGFLPFSNLVTHLDSFLPICRVNDFETADILCPKAKRTSRFLSGIINFIHFREACRETYMEFLWQYKSSADKMQQLNAAHQEALMKLERLDSVPVEEQEEFKQLSDGIQELQQSLNQDFHQKTIVLQEGNSQKKSNISEKTKRLNELKLSVVSLKEIQESLKTKIVDSPEKLKNYKEKMKDTVQKLKNARQEVVEKYEIYGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKEKLATAQFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTTINQEIQKIKLGIQQLKDAAEREKLKSQEIFLNLKTALEKYHDGIEKAAEDSYAKIDEKTAELKRKMFKMST DIP protein Q9BZD4 original sequence version: 113 DIP protein Q9BZD4 original sequence version: 119 250BFED5AD87153B ndc80-cdt1-1 4 11 unspecified role unspecified role bait bait human Homo sapiens Human 10 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association cdt1-ndc80-1 8 13 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association cdt1-ndc80-2 1 12 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association cdt1-ndc80-3 2 11 unspecified role unspecified role prey prey Region 306-642 Region 306-642 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdt1-ndc80-4 7 11 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region substitution Region 420-460 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain RKLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVP ASQGQGQGAAQGASSSGQQQGSASAASGAGQSASASAGGQQ human Homo sapiens Human 10 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association cdt1-ndc80-5 6 11 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association cdt1-gmnn-21 3 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdt1-ndc80-6 5 11 unspecified role unspecified role prey prey Region 306-642 Region 306-642 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association