DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Nature structural & molecular biology 2012 imex curation Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. Only protein-protein interactions neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. DIP original experiment: DIP-250948X Nature structural & molecular biology 2012 IMEx Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Nature structural & molecular biology 2012 imex curation Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. DIP original experiment: DIP-250950X Nature structural & molecular biology 2012 IMEx Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Nature structural & molecular biology 2012 imex curation Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. DIP original experiment: DIP-250951X Nature structural & molecular biology 2012 IMEx Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Nature structural & molecular biology 2012 imex curation Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. Only protein-protein interactions neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) tap tandem affinity purification TAP TAP tap de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. DIP original experiment: DIP-250940X Nature structural & molecular biology 2012 IMEx Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Nature structural & molecular biology 2012 imex curation Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. Only protein-protein interactions neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. DIP original experiment: DIP-250941X Nature structural & molecular biology 2012 IMEx Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Nature structural & molecular biology 2012 imex curation Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. Only protein-protein interactions neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. DIP original experiment: DIP-250945X Nature structural & molecular biology 2012 IMEx Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Nature structural & molecular biology 2012 imex curation Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. Only protein-protein interactions neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. DIP original experiment: DIP-250942X Nature structural & molecular biology 2012 IMEx Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Nature structural & molecular biology 2012 imex curation Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. Only protein-protein interactions neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. DIP original experiment: DIP-250947X Nature structural & molecular biology 2012 IMEx Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Nature structural & molecular biology 2012 imex curation Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. Only protein-protein interactions neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. DIP original experiment: DIP-250949X Nature structural & molecular biology 2012 IMEx Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Nature structural & molecular biology 2012 imex curation Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. Only protein-protein interactions neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. DIP original experiment: DIP-250943X Nature structural & molecular biology 2012 IMEx Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Nature structural & molecular biology 2012 imex curation Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. Only protein-protein interactions neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. DIP original experiment: DIP-250946X Nature structural & molecular biology 2012 IMEx Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. Nature structural & molecular biology 2012 imex curation Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. Only protein-protein interactions neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Honda S., Lewis ZA., Shimada K., Fischle W., Sack R., Selker EU. DIP original experiment: DIP-250944X Nature structural & molecular biology 2012 IMEx Heterochromatin protein 1 forms distinct complexes to direct histone deacetylation and DNA methylation. q3y3z1_neucr dim-2 NCU02247 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MDSPDRSHGGMFIDVPAETMGFQEDYLDMFASVLSQGLAKEGDYAHHQPLPAGKEECLEPIAVATTITPSPDDPQLQLQLELEQQFQTESGLNGVDPAPAPESEDEADLPDGFSDESPDDDFVVQRSKHITVDLPVSTLINPRSTFQRIDENDNLVPPPQSTPERVAVEDLLKAAKAAGKNKEDYIEFELHDFNFYVNYAYHPQEMRPIQLVATKVLHDKYYFDGVLKYGNTKHYVTGMQVLELPVGNYGASLHSVKGQIWVRSKHNAKKEIYYLLKKPAFEYQRYYQPFLWIADLGKHVVDYCTRMVERKREVTLGCFKSDFIQWASKAHGKSKAFQNWRAQHPSDDFRTSVAANIGYIWKEINGVAGAKRAAGDQLFRELMIVKPGQYFRQEVPPGPVVTEGDRTVAATIVTPYIKECFGHMILGKVLRLAGEDAEKEKEVKLAKRLKIENKNATKADTKDDMKNDTATESLPTPLRSLPVQVLEATPIESDIVSIVSSDLPPSENNPPPLTNGSVKPKAKANPKPKPSTQPLHAAHVKYLSQELVNKIKVGDVISTPRDDSSNTDTKWKPTDTDDHRWFGLVQRVHTAKTKSSGRGLNSKSFDVIWFYRPEDTPCCAMKYKWRNELFLSNHCTCQEGHHARVKGNEVLAVHPVDWFGTPESNKGEFFVRQLYESEQRRWITLQKDHLTCYHNQPPKPPTAPYKPGDTVLATLSPSDKFSDPYEVVEYFTQGEKETAFVRLRKLLRRRKVDRQDAPANELVYTEDLVDVRAERIVGKCIMRCFRPDERVPSPYDRGGTGNMFFITHRQDHGRCVPLDTLPPTLRQGFNPLGNLGKPKLRGMDLYCGGGNFGRGLEEGGVVEMRWANDIWDKAIHTYMANTPDPNKTNPFLGSVDDLLRLALEGKFSDNVPRPGEVDFIAAGSPCPGFSLLTQDKKVLNQVKNQSLVASFASFVDFYRPKYGVLENVSGIVQTFVNRKQDVLSQLFCALVGMGYQAQLILGDAWAHGAPQSRERVFLYFAAPGLPLPDPPLPSHSHYRVKNRNIGFLCNGESYVQRSFIPTAFKFVSAGEGTADLPKIGDGKPDACVRFPDHRLASGITPYIRAQYACIPTHPYGMNFIKAWNNGNGVMSKSDRDLFPSEGKTRTSDASVGWKRLNPKTLFPTVTTTSNPSDARMGPGLHWDEDRPYTVQEMRRAQGYLDEEVLVGRTTDQWKLVGNSVSRHMALAIGLKFREAWLGTLYDESAVVATATATATTAAAVGVTVPVMEEPGIGTTESSRPSRSPVHTAVDLDDSKSERSRSTTPATVLSTSSAAGDGSANAAGLEDDDNDDMEMMEVTRKRSSPAVDEEGMRPSKVQKVEVTVASPASRRSSRQASRNPTASPSSKASKATTHEAPAPEELESDAESYSETYDKEGFDGDYHSGHEDQYSEEDEEEEYAEPETMTVNGMTIVKL DIP protein Q3Y3Z1 original sequence version: 7 q7ry64_neucr Histone deacetylase hda-1 NCU01525 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MVDNDNDIVMDGQDTHPATIDVSATSNGITKTEPNGHDQSAPANDEKEEKLDDEKDPFIYPARLKRRGLLPTGCCYDDRMKLHANADFGPNPHHPEDPSRIEHIMRIFKKEGLVFTGDDEDLKKVIRTDPRRYMWRIPARHATKEEICIVHHPEHFRWVEDLSRKPTSELRRLSTIMDQGRDSLYVGSMTFEAALISAGGAIETCKSVVVGNVKNAFAVIRPPGHHAEFDAPMGFCLFNNVPIAAKICQTEYPEICRKILILDWDVHHGNGIQNMFYDDPNILYISLHVYMNGSFYPGKPDNPMTPDGSIENCGAGPGLGKNVNIGWHDQGMGDGEYMAAFQKIVMPIAHEFDPDLVIISAGFDAADGDELGACFVSPACYAHMTHMLMSLANGKVAVCLEGGYNLAAISKSALAVARTLMGEPPPKMDLPKINKEAARVLAKVQAYQAPYWECMRPGIVDVQEMQSQGGQRLHDVVRSAQRFNLSEKFGMFPLYIQRDVLFKSFENQVLVTRNASEARKLLVVIHDPPELHAQPDPLDNSLQPHDSWITDSIPQYIQWAINRKIGVIDINIPQYITHPEDTESLAPKVDERTQQAQIQELMCYIWDNYLQLYDNVDDIFLMGVGNAYLGVKLLLINRDVKSRISGVVNFVNGNLRPVKSDVDTDLSSWYKDNSRVYVSADHACWADADLSRKVMKRRFGSVIRSNVSGLGRMMNEHFKDVQDWMVDRMVPEEEKLGDEMVEDA DIP protein Q7RY64 original sequence version: 51 h3_neucr Histone H3 hh3 B7K22.030 NCU01635 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQESVESYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERN DIP protein P07041 original sequence version: 112 9AF51E808E698349 q1k551_neucr chap NCU01796 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MPYDPDLYPDDDPIDNFNYDPKDDYDELGDDYDPDLDPNQQGDHEEDVDEFYDAEDVEDEPSLQAPVKVPQHPRRATLSPLQPSRSERHATPTSTSVRDGTPRSARVAVMLPVSVKKEAYISVPDVASDEEEEEEEKEKEEDTMVGSFVTSDLMPPTPKRRKITERPSTKPTPTVPAPNYVPPKVQPPPFPIPDIPAPVPLVNPTKKRGRPFGWRPGLSYAAMRGNPVPPPRPKVPKQPKAPSEVKRRGRPPKKPHELPREIFSKLTPRYIRFLCEWEGCPAELHNFETLRKHVLVVHGDYRQPHQHHLLSAREQPQEPKTCKWASCHSKRLQSELPPLTLPTRSHFEAHVNESHLIPFLWHVGDGPRNTSIESPLSEKPLTITSALPSQPLSSSSISHLDVTTTTTTNTTTTSTAIKLQPLPPYLFDTSGNQVTPSVRDQLYENDDDKRRRRVRLERVHFLRDENAAPEPVYTQAERDAMEASLAAKKKKQDEFWEYYEKVMGPVVEVTVLAADQEDLEVPENASGNLSKEVKRKMLSCGWDPQWRGLYQD DIP protein Q1K551 original sequence version: 6 h2a_neucr Histone H2A hh2a hta-1 NCU02437 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MTGGGKSGGKASGSKNAQSRSSKAGLAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTGKTGKNASQEL DIP protein Q8X132 original sequence version: 80 h2b_neucr Histone H2B hh2b NCU02435 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MPPKPADKKPASKAPATASKAPEKKDAGKKTAASGDKKKRTKARKETYSSYIYKVLKQVHPDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAKHAVSEGTKAVTKYSSSTK DIP protein P37210 original sequence version: 98 cdp2 Predicted protein protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) This sequence has been withdrawn from Uniprot. The sequence has been withdrawn from uniprot. h3k9me3 H3K9me3 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ARTKQTARKSTGGKAY q1k612_neucr hpo NCU04017 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MPYDPSALSDEEAASSVELDTRSATSSSKKQSRDKKSVKYTIPEPEDFEDEEQNGDGADEGGEDDEEGDEEEEDVYVVEKILDHMLNDDNEPLFLVKWEGYEKKSDQTWEPEDTLIEGASERLKEYFTKIGGREKIFEASAAAQKIKKRGRPSSNSGTPQASSNKRSRKNGDHPLNSEEPQTAKNAAWKPPAGSWEEHIAQLDACEDEDTHKLMVYLTWKNGHKTQHTTDVIYKRCPQKMLQFYERHVRIIKRDPDSEDREGSVSQ DIP protein Q1K612 original sequence version: 7 h3k27-2 Histone 3 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) QLATKAARKSAPATGGVY h4_neucr Histone H4 hH4-1 hhf1 B7K22.020 NCU01634 hH4-2 hhf2 NCU00212 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MTGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG DIP protein P04914 original sequence version: 101 dim_2-hpo-1 6 21 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 13 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) physical association physical association cdp2-chap-1 4 16 unspecified role unspecified role prey prey neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 21 unspecified role unspecified role prey prey neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 14 unspecified role unspecified role prey prey neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 19 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) association association chap-hpo-1 10 16 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 21 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) physical association physical association cdp2-hpo-1 9 19 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 21 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) physical association physical association chap-cdp2-1 8 19 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 16 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) physical association physical association hda_1-cdp2-1 11 19 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 14 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) physical association physical association hpo-dim_2-1 12 21 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 13 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) physical association physical association hda_1-hpo-1 7 21 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 14 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) physical association physical association cdp2-h3k9-1 2 20 unspecified role unspecified role unspecified role unspecified role Fluorescein-label Fluorescein-label fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined K9me1 K9me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm K9me2 K9me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm K9me3 K9me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro 19 unspecified role unspecified role unspecified role unspecified role Chromodomain Region 397-572 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal ecolx Escherichia coli direct interaction direct interaction dim_2-hh2a-1 5 23 unspecified role unspecified role prey prey neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 15 unspecified role unspecified role prey prey neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 18 unspecified role unspecified role prey prey neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 17 unspecified role unspecified role prey prey neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 21 unspecified role unspecified role prey prey neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 13 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) association association cdp2-h3k27-1 3 22 unspecified role unspecified role unspecified role unspecified role K9me3 K9me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm Fluorescein-label Fluorescein-label fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 19 unspecified role unspecified role unspecified role unspecified role Chromodomain Region 397-572 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal ecolx Escherichia coli direct interaction direct interaction hpo-cdp2-1 1 19 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 21 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 13 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) association association