DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the c(10) ring of the yeast mitochondrial ATP synthase in the open conformation. Structure of the c(10) ring of the yeast mitochondrial ATP synthase in the open conformation. Nature structural & molecular biology 2012 imex curation Symersky J., Pagadala V., Osowski D., Krah A., Meier T., Faraldo-Gómez JD., Mueller DM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Symersky J., Pagadala V., Osowski D., Krah A., Meier T., Faraldo-Gómez JD., Mueller DM. DIP original experiment: DIP-250939X Nature structural & molecular biology 2012 IMEx Structure of the c(10) ring of the yeast mitochondrial ATP synthase in the open conformation. atp9_yeast ATP synthase subunit 9, mitochondrial OLI1 ATP9 Lipid-binding protein OLI3 Oligomycin resistance protein 1 PHO2 Q0130 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLLLFGV 82B4477D6F75D758 82B4477D6F75D758 c_ring-1 1 2 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction