DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Nature structural & molecular biology 2012 imex curation Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. DIP original experiment: DIP-255475X Nature structural & molecular biology 2012 IMEx Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Nature structural & molecular biology 2012 imex curation Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. DIP original experiment: DIP-255488X Nature structural & molecular biology 2012 IMEx Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Nature structural & molecular biology 2012 imex curation Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. DIP original experiment: DIP-255476X Nature structural & molecular biology 2012 IMEx Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Nature structural & molecular biology 2012 imex curation Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. DIP original experiment: DIP-255479X Nature structural & molecular biology 2012 IMEx Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Nature structural & molecular biology 2012 imex curation Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. DIP original experiment: DIP-255474X Nature structural & molecular biology 2012 IMEx Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Nature structural & molecular biology 2012 imex curation Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. DIP original experiment: DIP-255482X Nature structural & molecular biology 2012 IMEx Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Nature structural & molecular biology 2012 imex curation Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. DIP original experiment: DIP-255473X Nature structural & molecular biology 2012 IMEx Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Nature structural & molecular biology 2012 imex curation Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. DIP original experiment: DIP-255477X Nature structural & molecular biology 2012 IMEx Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Nature structural & molecular biology 2012 imex curation Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. DIP original experiment: DIP-255484X Nature structural & molecular biology 2012 IMEx Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Nature structural & molecular biology 2012 imex curation Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. DIP original experiment: DIP-255480X Nature structural & molecular biology 2012 IMEx Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Nature structural & molecular biology 2012 imex curation Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. DIP original experiment: DIP-255487X Nature structural & molecular biology 2012 IMEx Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Nature structural & molecular biology 2012 imex curation Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. DIP original experiment: DIP-255481X Nature structural & molecular biology 2012 IMEx Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Nature structural & molecular biology 2012 imex curation Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. DIP original experiment: DIP-255485X Nature structural & molecular biology 2012 IMEx Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Nature structural & molecular biology 2012 imex curation Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. DIP original experiment: DIP-255486X Nature structural & molecular biology 2012 IMEx Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Nature structural & molecular biology 2012 imex curation Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. DIP original experiment: DIP-255483X Nature structural & molecular biology 2012 IMEx Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. Nature structural & molecular biology 2012 imex curation Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gibbings D., Leblanc P., Jay F., Pontier D., Michel F., Schwab Y., Alais S., Lagrange T., Voinnet O. DIP original experiment: DIP-255478X Nature structural & molecular biology 2012 IMEx Human prion protein binds Argonaute and promotes accumulation of microRNA effector complexes. dicer_mouse Endoribonuclease Dicer Dicer1 Dicer Mdcr Double-strand-specific ribonuclease mDCR-1 protein protein mouse Mus musculus Mouse MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELAHQIRGDLNPHAKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSDLEVNASWTKERWSQEFTKHQVLIMTCYVALTVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCESCPSCPRILGLTASILNGKCDPEELEEKIQKLERILRSDAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEAALDFINDCNVAVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTLLRKIHALCEEYFSPASLDLKYVTPKVMKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDDDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRSKQMEAEFRKQEEVLRKFRAHETNLLIATSVVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYVMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSADGAEADVHAGVDDEDAFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPDGTFYSTLYLPINSPLRASIVGPPMDSVRLAERVVALICCEKLHKIGELDEHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRESYPKPDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFTLSQQMLELITRLHQYIFSHILRLEKPALEFKPTGAESAYCVLPLNVVNDSGTLDIDFKFMEDIEKSEARIGIPSTKYSKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTASDAGVGVRSLPVDFRYPNLDFGWKKSIDSKSFISTCNSSLAESDNYCKHSTTVVPEHAAHQGATRPSLENHDQMSVNCKRLPAESPAKLQSEVSTDLTAINGLSYNKNLANGSYDLVNRDFCQGNQLNYFKQEIPVQPTTSYPIQNLYNYENQPKPSNECPLLSNTYLDGNANTSTSDGSPAVSTMPAMMNAVKALKDRMDSEQSPSVGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSNSEKWEKDEMTKDCLLANGKLGEACEEEEDLTWRAPKEEAEDEDDFLEYDQEHIQFIDSMLMGSGAFVRKISLSPFSASDSAYEWKMPKKASLGSMPFASGLEDFDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTSREKALDPAQENGSSQQKSLSGSCAAPVGPRSSAGKDLEYGCLKIPPRCMFDHPDAEKTLNHLISGFETFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQVPNS DIP protein Q8R418 original sequence version: 123 DIP protein Q8R418 original sequence version: 60 DIP protein Q8R418 original sequence version: 101 D97EA17922D7E79C prp Prion Octarepeat peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) GSRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGLE q9upy3-1 Endoribonuclease Dicer DICER1 DICER HERNA KIAA0928 Helicase with RNase motif protein protein human Homo sapiens Human MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYIMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGETDIDPVMDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPDGTFYSTLYLPINSPLRASIVGPPMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPRPDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFMLSLQMLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTASDAGVGVRSLPADFRYPNLDFGWKKSIDSKSFISISNSSSAENDNYCKHSTIVPENAAHQGANRTSSLENHDQMSVNCRTLLSESPGKLHVEVSADLTAINGLSYNQNLANGSYDLANRDFCQGNQLNYYKQEIPVQPTTSYSIQNLYSYENQPQPSDECTLLSNKYLDGNANKSTSDGSPVMAVMPGTTDTIQVLKGRMDSEQSPSIGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSNTDKWEKDEMTKDCMLANGKLDEDYEEEDEEEESLMWRAPKEEADYEDDFLEYDQEHIRFIDNMLMGSGAFVKKISLSPFSTTDSAYEWKMPKKSSLGSMPFSSDFEDFDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVSCAAASVASSRSSVLKDSEYGCLKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQVPNS DIP protein Q9UPY3-1 original sequence version: 139 DIP protein Q9UPY3 original sequence version: 66 DIP protein Q9UPY3 original sequence version: 82 DIP protein Q9UPY3 original sequence version: 95 DIP protein Q9UPY3 original sequence version: 89 DIP protein Q9UPY3 original sequence version: 92 DIP protein Q9UPY3 original sequence version: 135 DIP protein Q9UPY3 original sequence version: 123 DIP protein Q9UPY3 original sequence version: 113 ago1_human Protein argonaute-1 AGO1 Argonaute RISC catalytic component 1 EIF2C1 Eukaryotic translation initiation factor 2C 1 Putative RNA-binding protein Q99 protein protein human Homo sapiens Human MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIKPDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGEGKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYGGRNRAIATPNQGVWDMRGKQFYNGIEIKVWAIACFAPQKQCREEVLKNFTDQLRKISKDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVFQQPVIFLGADVTHPPAGDGKKPSITAVVGSMDAHPSRYCATVRVQRPRQEIIEDLSYMVRELLIQFYKSTRFKPTRIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKNERIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKEHDSGEGSHISGQSNGRDPQALAKAVQVHQDTLRTMYFA DIP protein Q9UL18 original sequence version: 46 DIP protein Q9UL18 original sequence version: 57 DIP protein Q9UL18 original sequence version: 80 DIP protein Q9UL18 original sequence version: 99 1DBB524AE7CBAF66 prio_human Major prion protein PrP27-30 PrP33-35C ASCR PRNP PRIP PRP ALTPRP protein protein human Homo sapiens Human MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPVILLISFLIFLIVG DIP protein P04156 original sequence version: 125 DIP protein P04156 original sequence version: 122 DIP protein P04156 original sequence version: 147 DIP protein P04156 original sequence version: 141 DIP protein P04156 original sequence version: 166 DIP protein P04156-1 original sequence version: 166 43DB596BAAA66484 tnr6a_mouse Trinucleotide repeat-containing gene 6A protein Tnrc6a Kiaa1460 protein protein mouse Mus musculus Mouse MRELEAKATKDVERNLSRDLVQEEEQLMEEKKKKKDDKKKKEAAQKKATEQKIKVPEQIKPSVSQPQPANSDNGTSTATSTNNNAKRATASNQQPPPPQQQQPQQEQQQQQPQALPRYPREVPPRFRHQEHKQLLKRGQHFPVIAANLGSAVKVLNSQSESSAVTNQQPQNNGEVQNSKSQSDINHNTSGSHYENCQRGPVSSTSDCSTSCKNAVNDLLEKEAWPSAPGSDPELAPECIDADSASNSESERNITVMASGNTGGEKDGLRNSTGLGSQSKFVVGSSSNNVGHGSSTGPWGFPHGALISTCQVSVDAPESKPESSNNRMNAWGTVSSSSNGGLNPSTLNSASNHGAWPVLENNGLALKGPVGSGSSGINIQCSTIGQMPNNQNINSKVSGSSTHGTWGSLQETCEPEVSGTQKVSFSGQPQNITTETTGPNNTTNFMTSSLPNSGSVQNNELPTSNPGAWRVSTMNHPQIQAPSVMNGTSLSHLSNGESKTGGSYGTTWGAYGSNYSGDKCAGPNGQANGDTVNATLMQPGINGPMGTNFQVNTNKGGGVWEPGTVNSQSSPWGSGNGANSGGSRRGWGSPAQNTGTGLSSVEWNKLPSNQHSNDSANGNGKKLTNGWKSTEEDDQGSATSQTNEQNSVWAKAGGTVESDGSAESTGRLEEKVTGESQSRDRRKIDQHTLLQSIVNRTDLDPRVLSNSGWGQTPIKQNTAWDTETSPRGERKTDNGTEAWGSSATQTFNSGACTDKTSPNSNDTSSVSGWGDPKPTLRWGDSKGSNCQGGWEDDSAATGMIKSNQWGGCKEDKSTWNDSQKSKQGWGDGQKSSQGWSISAGDNWGESSRSNHWGEANKKSSSGGSDSDRSISGWNELGKTSSFTWGNNINPNNSSGWDESSKPNSSQGWGDPPKCNQSLGWGDSSKPVSSPDWNKQQDIVGSWGIPPATSKPPGTGWLGGPIPAPAKEEEPTGWEEPSPESIRRKMEIDDGTSAWGDPSKYNYKNVNMWNKNIPEASGRSDQQAQMHRLLPAASAVSSKETSSGSGWGEPWAEPSTPATTVDNGTSAWGKPIDSGPSWGEPITAASNASTWGSSSVGPQSLSKSGPKSMQDGWCGDDMPLPGSRPTGWEEEEDVEIGMWNSNSSQELNSSLNWPPYTKKMSSKGLSGKKRRRERGMMKGGNKQEDAWINPFVKQFSNISFSRDSPEENVQSNKMDLSGGMLQDKRMEIDKHSLNIGDYNRTVGKGPGSRPQISKESSMERNPYFDKNGNPNMFGVGNTAAQPRGMQQPPAQPLSSSQPNLRAQVPPPLLSPQVPVSLLKYAPNNGGLNPLFGPQQVAMLNQLSQLNQLSQISQLQRLLAQQQRAQSQRSAPSANRQQQDQQGRPLSVQQQMMQQSRQLDPSLLVKQQTPPSQQPLHQPAMKSFLDNVMPHTTPELQKGPSPVNAFSNFPIGLNSNLNVNMDMNSIKEPQSRLRKWTTVDSMSVNTSLDQNSSKHGAISSGFRLEESPFVPYDFMNSSTSPASPPGSIGDGWPRAKSPNGSSSVNWPPEFRPGEPWKGYPNIDPETDPYVTPGSVINSLSINTVREVDHLRDRNSGSSSSLNTTLPSTSAWSSIRASNYNVPLSSTAQSTSARNSDSKLTWSPGSVTNTSLAHELWKVPLPPKNITAPSRPPPGLTGQKPPLSTWDNSPLRVGGGWGNSDARYTPGSSWGESSSGRITNWLVLKNLTPQIDGSTLRTLCMQHGPLITFHLNLPHGNALVRYSSKEEVVKAQKSLHMCVLGNTTILAEFASEEEISRFFAQSQSLTPSPGWQSLGSSQSRLGSLDCSHSFSSRTDVNHWNGAGLSGANCGDLHGTSLWGTPHYSTSLWGPPSSDPRGISSPSPINAFLSVDHLGGGGESM DIP protein Q3UHK8 original sequence version: 68 58858C69497903BF tnr6a_human Trinucleotide repeat-containing gene 6A protein TNRC6A CAGH26 KIAA1460 TNRC6 CAG repeat protein 26 Glycine-tryptophan protein of 182 kDa GW182 autoantigen EMSY interactor protein protein protein human Homo sapiens Human MRELEAKATKDVERNLSRDLVQEEEQLMEEKKKKKDDKKKKEAAQKKATEQKIKVPEQIKPSVSQPQPANSNNGTSTATSTNNNAKRATANNQQPQQQQQQQQPQQQQPQQQPQPQPQQQQPQQQPQALPRYPREVPPRFRHQEHKQLLKRGQHFPVIAANLGSAVKVLNSQSESSALTNQQPQNNGEVQNSKNQSDINHSTSGSHYENSQRGPVSSTSDSSTNCKNAVVSDLSEKEAWPSAPGSDPELASECMDADSASSSESERNITIMASGNTGGEKDGLRNSTGLGSQNKFVVGSSSNNVGHGSSTGPWGFSHGAIISTCQVSVDAPESKSESSNNRMNAWGTVSSSSNGGLNPSTLNSASNHGAWPVLENNGLALKGPVGSGSSGINIQCSTIGQMPNNQSINSKVSGGSTHGTWGSLQETCESEVSGTQKVSFSGQPQNITTEMTGPNNTTNFMTSSLPNSGSVQNNELPSSNTGAWRVSTMNHPQMQAPSGMNGTSLSHLSNGESKSGGSYGTTWGAYGSNYSGDKCSGPNGQANGDTVNATLMQPGVNGPMGTNFQVNTNKGGGVWESGAANSQSTSWGSGNGANSGGSRRGWGTPAQNTGTNLPSVEWNKLPSNQHSNDSANGNGKTFTNGWKSTEEEDQGSATSQTNEQSSVWAKTGGTVESDGSTESTGRLEEKGTGESQSRDRRKIDQHTLLQSIVNRTDLDPRVLSNSGWGQTPIKQNTAWDTETSPRGERKTDNGTEAWGSSATQTFNSGACIDKTSPNGNDTSSVSGWGDPKPALRWGDSKGSNCQGGWEDDSAATGMVKSNQWGNCKEEKAAWNDSQKNKQGWGDGQKSSQGWSVSASDNWGETSRNNHWGEANKKSSSGGSDSDRSVSGWNELGKTSSFTWGNNINPNNSSGWDESSKPTPSQGWGDPPKSNQSLGWGDSSKPVSSPDWNKQQDIVGSWGIPPATGKPPGTGWLGGPIPAPAKEEEPTGWEEPSPESIRRKMEIDDGTSAWGDPSKYNYKNVNMWNKNVPNGNSRSDQQAQVHQLLTPASAISNKEASSGSGWGEPWGEPSTPATTVDNGTSAWGKPIDSGPSWGEPIAAASSTSTWGSSSVGPQALSKSGPKSMQDGWCGDDMPLPGNRPTGWEEEEDVEIGMWNSNSSQELNSSLNWPPYTKKMSSKGLSGKKRRRERGMMKGGNKQEEAWINPFVKQFSNISFSRDSPEENVQSNKMDLSGGMLQDKRMEIDKHSLNIGDYNRTVGKGPGSRPQISKESSMERNPYFDKDGIVADESQNMQFMSSQSMKLPPSNSALPNQALGSIAGLGMQNLNSVRQNGNPSMFGVGNTAAQPRGMQQPPAQPLSSSQPNLRAQVPPPLLSPQVPVSLLKYAPNNGGLNPLFGPQQVAMLNQLSQLNQLSQISQLQRLLAQQQRAQSQRSVPSGNRPQQDQQGRPLSVQQQMMQQSRQLDPNLLVKQQTPPSQQQPLHQPAMKSFLDNVMPHTTPELQKGPSPINAFSNFPIGLNSNLNVNMDMNSIKEPQSRLRKWTTVDSISVNTSLDQNSSKHGAISSGFRLEESPFVPYDFMNSSTSPASPPGSIGDGWPRAKSPNGSSSVNWPPEFRPGEPWKGYPNIDPETDPYVTPGSVINNLSINTVREVDHLRDRNSGSSSSLNTTLPSTSAWSSIRASNYNVPLSSTAQSTSARNSDSKLTWSPGSVTNTSLAHELWKVPLPPKNITAPSRPPPGLTGQKPPLSTWDNSPLRIGGGWGNSDARYTPGSSWGESSSGRITNWLVLKNLTPQIDGSTLRTLCMQHGPLITFHLNLPHGNALVRYSSKEEVVKAQKSLHMCVLGNTTILAEFASEEEISRFFAQSQSLTPSPGWQSLGSSQSRLGSLDCSHSFSSRTDLNHWNGAGLSGTNCGDLHGTSLWGTPHYSTSLWGPPSSSDPRGISSPSPINAFLSVDHLGGGGESM DIP protein Q8NDV7 original sequence version: 97 963C054628E18592 prio_mesau Major prion protein PrP27-30 PrP33-35C PRNP PRP protein protein mesau Mesocricetus auratus (Golden hamster) Golden hamster MANLSYWLLALFVAMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGTWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHNQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPMMHFGNDWEDRYYRENMNRYPNQVYYRPVDQYNNQNNFVHDCVNITIKQHTVTTTTKGENFTETDIKIMERVVEQMCTTQYQKESQAYYDGRRSSAVLFSSPPVILLISFLIFLMVG DIP protein P04273 original sequence version: 95 DIP protein P04273 original sequence version: 100 DIP protein P04273-1 original sequence version: 104 442C0E3ED4D20672 ago2_human Protein argonaute-2 AGO2 Argonaute RISC catalytic component 2 EIF2C2 Eukaryotic translation initiation factor 2C 2 PAZ Piwi domain protein Protein slicer protein protein human Homo sapiens Human MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQALAKAVQVHQDTLRTMYFA DIP protein Q9UKV8 original sequence version: 1(def) DIP protein Q9UKV8 original sequence version: 44 DIP protein Q9UKV8 original sequence version: 60 DIP protein Q9UKV8 original sequence version: 62 DIP protein Q9UKV8 original sequence version: 89 DIP protein Q9UKV8 original sequence version: 85 DIP protein Q9UKV8 original sequence version: 87 DIP protein Q9UKV8 original sequence version: 99 DIP protein Q9UKV8 original sequence version: 117 DIP protein Q9UKV8-1 original sequence version: 117 DIP protein Q9UKV8 original sequence version: 145 DIP protein Q9UKV8 original sequence version: 108 5C8552C43FC81345 ago2_mouse Protein argonaute-2 Ago2 Argonaute RISC catalytic component 2 Eif2c2 Eukaryotic translation initiation factor 2C 2 Kiaa4215 Piwi/argonaute family protein meIF2C2 Protein slicer protein protein mouse Mus musculus Mouse MYSGAGPVLASPAPTTSPIPGYAFKPPPRPDFGTTGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQALAKAVQVHQDTLRTMYFA DIP protein Q8CJG0 original sequence version: 61 DIP protein Q8CJG0 original sequence version: 83 A4E13C633846062C tnrc6a-ago1-1 7 25 unspecified role unspecified role prey prey human Homo sapiens Human 20 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role bait bait human Homo sapiens Human association association ago1-prnp-1 6 20 unspecified role unspecified role bait bait human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association dicer1-ago2-2 8 25 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human 19 unspecified role unspecified role bait bait human Homo sapiens Human association association ago2-prnp-1 14 26 unspecified role unspecified role bait bait mouse Mus musculus Mouse 24 unspecified role unspecified role prey prey P04273:p.[Ala113Val;Ala115Val;Ala118Val] A113V/A115V/A118V mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain A V certain certain sequence position certain certain certain sequence position certain A V certain certain sequence position certain certain certain sequence position certain A V This feature has been corrected as a result of our quality control procedures. The original label was 'A113V/A115V/A118V'. Wed May 02 16:14:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala113val,ala115val,ala118val' Tue Jun 30 17:36:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala113Val;Ala115Val;Ala118Val]' mouse Mus musculus Mouse physical association physical association prp-ago1-1 2 25 unspecified role unspecified role prey prey human Homo sapiens Human 20 unspecified role unspecified role prey prey human Homo sapiens Human 18 unspecified role unspecified role bait bait prp:p.[Trp12Ala;Trp20Ala;Trp28Ala;Trp36Ala;Trp44Ala] W12A/W20A/W28A/W36A/W44A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W12A/W20A/W28A/W36A/W44A'. Wed May 02 14:44:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp12ala,trp20ala,trp28ala,trp36ala,trp44ala' Tue Jun 30 17:17:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp12Ala;Trp20Ala;Trp28Ala;Trp36Ala;Trp44Ala]' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal ecolx Escherichia coli association association tnrc6a-ago2-1 5 25 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association tnrc6a-ago2-2 16 25 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role bait bait human Homo sapiens Human association association prnp-ago2-1 11 26 unspecified role unspecified role prey prey mouse Mus musculus Mouse 24 unspecified role unspecified role bait bait P04273:p.[Ala113Val;Ala115Val;Ala118Val] A113V/A115V/A118V mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain A V certain certain sequence position certain certain certain sequence position certain A V certain certain sequence position certain certain certain sequence position certain A V This feature has been corrected as a result of our quality control procedures. The original label was 'A113V/A115V/A118V'. Wed May 02 16:04:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala113val,ala115val,ala118val' Tue Jun 30 15:41:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala113Val;Ala115Val;Ala118Val]' mouse Mus musculus Mouse physical association physical association prnp-ago2-2 1 25 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait human Homo sapiens Human 19 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human association association prnp-dicer1-1 15 17 unspecified role unspecified role prey prey mouse Mus musculus Mouse 22 unspecified role unspecified role prey prey mouse Mus musculus Mouse 21 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association prnp-dicer1-2 4 23 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait human Homo sapiens Human 19 unspecified role unspecified role prey prey human Homo sapiens Human association association prnp-ago2-3 9 26 unspecified role unspecified role prey prey mouse Mus musculus Mouse 21 unspecified role unspecified role bait bait P04156:p.Ala117Val A117V mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain A V This feature has been corrected as a result of our quality control procedures. The original label was 'A117V'. Wed May 02 17:07:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala117val' Tue Jun 30 18:30:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala117Val' mouse Mus musculus Mouse physical association physical association prnp-ago2-4 3 25 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait human Homo sapiens Human 19 unspecified role unspecified role prey prey human Homo sapiens Human association association prnp-ago2-5 10 25 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association ago2-prnp-2 12 25 unspecified role unspecified role bait bait human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association ago2-prnp-3 13 26 unspecified role unspecified role bait bait mouse Mus musculus Mouse 21 unspecified role unspecified role prey prey P04156:p.Ala117Val A117V mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain A V This feature has been corrected as a result of our quality control procedures. The original label was 'A117V'. Wed May 02 17:30:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala117val' Tue Jun 30 16:47:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala117Val' mouse Mus musculus Mouse physical association physical association