DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. Structure (London, England : 1993) 2012 imex curation Moore JO., Hendrickson WA. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Moore JO., Hendrickson WA. DIP original experiment: DIP-249327X Structure (London, England : 1993) 2012 IMEx An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. Structure (London, England : 1993) 2012 imex curation Moore JO., Hendrickson WA. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Moore JO., Hendrickson WA. DIP original experiment: DIP-249331X Structure (London, England : 1993) 2012 IMEx An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. Structure (London, England : 1993) 2012 imex curation Moore JO., Hendrickson WA. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Moore JO., Hendrickson WA. DIP original experiment: DIP-249330X Structure (London, England : 1993) 2012 IMEx An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. Structure (London, England : 1993) 2012 imex curation Moore JO., Hendrickson WA. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Moore JO., Hendrickson WA. DIP original experiment: DIP-249328X Structure (London, England : 1993) 2012 IMEx An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. Structure (London, England : 1993) 2012 imex curation Moore JO., Hendrickson WA. Only protein-protein interactions ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Moore JO., Hendrickson WA. DIP original experiment: DIP-249329X Structure (London, England : 1993) 2012 IMEx An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. Structure (London, England : 1993) 2012 imex curation Moore JO., Hendrickson WA. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Moore JO., Hendrickson WA. DIP original experiment: DIP-249326X Structure (London, England : 1993) 2012 IMEx An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO. q87id2_vibpa VPA0674 protein protein vibpa vibpa MVINQRSIRTIFKHSVLAASLCASLPSVAAEKICAIYPHLKDSYWLSVNYGMVSEAEKQGVNLRVLEAGGYPNKSRQEQQLALCTQWGANAIILGTVDPHAYEHNLKSWVGNTPVFATVNQLDLDEEQSTLLKGEVGVDWYWMGYEAGKYLAERHPKGSGKTNIALLLGPRTRGGTKPVTTGFYEAIKNSDIHIVDSFWADNDKELQRNLVQRVIDMGNIDYIVGSAVAIEAAISELRSADKTHDIGLVSVYLSHGVYRGLLRNKVLFAPTDKMVQQGRLSVMQAAHYLRHQPYEKQASPIIKPLTPKTLHDDTIEESLSPSEYRPTFSIKAVD 68DE77CD2FF93390 q87id1_vibpa Phosphorelay protein LuxU VPA0675 protein protein vibpa vibpa MLLATASIGRKLLLSFIAMAMLVMLSALIGVSGFSLVAKTERNVVDAAIPAMIEARQVSELSTRIISSVQMLSNAQNEQERKEAGRVLFEQLESLLTHIKELGGESFDSKLLDALESNVQNVINNLAELGVTVERKLWLAKEIDTRVEEMRLLSEELEQLTRTQVQNTSTIAVANVTHIYDLLEANKKDQVYQALDALVEVDLDLTERLHELHLLAFKMLNQIEEARTLTNVDRIQQIQTAFENNLKIMKRRVLAVEDPTRSKQMSQLLTELGKRQVVFTILLQQYENNEQSQQLMQKTLELFSELNSTVNKLVDDSNKTTTFAVDQLTNTLKFAQWSLTVISIVGLIVVVLILWRVVYVSVVKRLAEYSAALLSVAQGNLAVELEVKGKDELAHMGQAIITARNTAQALKVVAEGEAKAKRELEEHKEHLEELIEQRTSQLRQANLRLNEEVVNHAQARNEAEQASRAKSAFLATMSHEIRTPMNGVLGTARLLMDSGLNPIQKRYAEIINRSGKTLLAILNDVLDYSKIEAGHLEIRRLGFDLHQMVEDTFQLMNSRAQEKQLLFSYHIESDVSRYWKGDVTRISQVLNNLVGNAIKFTEDGEIDIYVSLNPEDESQVLFEVSDTGIGISKKDQKTLFDAFTQAEGGLNQIGGTGLGLAISKRIVEAMGGVLEVDSEEGEGSRFWFSIPLEESEPVEIGVVASARCKVKAKVLLVEDNEVNRVVAEGFLQSMGHQVVMAEDGLQAERIIDKQDFDIALVDINLPDCDGTDLIQRLKRIERNKPGDKALSPTPMIAVSAHVFAEEVERYLAAGFDGYLPKPVEKEALATLIQDVLDGKQLLLPQSGECLPLSETSDTNLTIENQVEQDHQQREEPEMVIINPSVIQSDMKILGREKMLHIIDLFRNTSADVLGQLVESAEKNDSLAVKNLAHKLKGSAGSLGLTALMNTCQSIEIAAEPLDTYNAQQGLLDEQVATSVNALDELMAE 962F67DF6A44BC72 tors-tort-1 4 7 unspecified role unspecified role unspecified role unspecified role Region 29-329 Region 29-329 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 51-323 Region 51-323 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tors-tort-2 6 7 unspecified role unspecified role unspecified role unspecified role Region 29-329 Region 29-329 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 51-323 Region 51-323 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tors-tort-3 2 7 unspecified role unspecified role unspecified role unspecified role Region 29-329 Region 29-329 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 51-323 Region 51-323 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tors-3 5 8 unspecified role unspecified role unspecified role unspecified role Region 51-323 Region 51-323 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tors-tort-4 1 7 unspecified role unspecified role unspecified role unspecified role Region 29-329 Region 29-329 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 51-323 Region 51-323 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tors-tort-5 3 7 unspecified role unspecified role unspecified role unspecified role Region 29-329 Region 29-329 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 309-329 Region 309-329 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 51-323 Region 51-323 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction