DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249372X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249368X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249369X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249376X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249377X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249366X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249382X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down predetermined predetermined participant predetermined Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249367X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249380X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249373X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249374X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249370X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions human Homo sapiens Human ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249378X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249381X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249384X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249383X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249379X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249371X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. Mediator acts upstream of the transcriptional activator Gal4. PLoS biology 2011 imex curation Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ang K., Ee G., Ang E., Koh E., Siew WL., Chan YM., Nur S., Tan YS., Lehming N. DIP original experiment: DIP-249375X PLoS biology 2011 IMEx Mediator acts upstream of the transcriptional activator Gal4. das1_yeast F-box protein DAS1 YJL149W J0634 DAS1 DST1-delta 6-azauracil sensitivity protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPFQDYFQKKKAAFINRNNKSNADASALRDINDININFAAKSKNYVFPLTKLPDELMQEVFSHLPQPDRLQLCLVNKRLNKIATKLLYRRIYLNDSNVVKSDFMHLAINWTLLNLPSSLKEEESRDIANCKLKKLIETLQNNIHITEVIQWIRINWDLDSTLQRSILSILCNQGKSLQRLENVTDPACNDIISNGHFSRSNVSSFDMAPPNSLPEMVVPENYIPNLTKYLSQRISSRLSHMTLFIDPLKLFNYLYPLDIKLQIIDLKLHWRREFYNNDYFVKKIRPGNPLTKLSEVFDKRTLKILTIISWNDTLLKRETEMLKDFKEFENLEDLSLISIKQDVHILVDLFSSLTNLKRLKMDFLEEYVPEPTNPHIFLSILLACSKLQFIDLRYDGLIPQIINIQENKFQLNQQCNCTNCQIVFSDILKGKIFMFPEDYYIHDLQDIAAKDIFKMMKYLSLLPYSKACDAYPSVRTQPMNLTNFVTKMNRNLLEYRNSKSQLVPKIVNNPHQHSTVTSTSTAHMSEPEMIIIDDDDDDDEINAAIPPSSDDTAATISTDLELPHESLTKRDIIMCYHALIHHFKSIYVTFLKSFPHLRFLMLNDIPTIVMEENNERIFEPVFYHYDYKSNLYGWSKESNKNLENDSNNNNNNSDTIARIATVM C48B6CAB40920027 C48B6CAB40920027 cul1_human Cullin-1 CUL1 protein protein human Homo sapiens Human MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA DIP protein Q13616 original sequence version: 144 DIP protein Q13616 original sequence version: 133 DIP protein Q13616 original sequence version: null DIP protein Q13616 original sequence version: 135 DIP protein Q13616 original sequence version: 98 DIP protein Q13616 original sequence version: 110 DIP protein Q13616 original sequence version: 146 DIP protein Q13616 original sequence version: 148 DIP protein Q13616 original sequence version: 100 DIP protein Q13616 original sequence version: 85 DIP protein Q13616 original sequence version: 114 DIP protein Q13616 original sequence version: 119 DIP protein Q13616 original sequence version: 136 DIP protein Q13616 original sequence version: 117 DIP protein Q13616 original sequence version: 99 DIP protein Q13616 original sequence version: 108 6625A1FFA7799BBA med10_yeast Mediator of RNA polymerase II transcription subunit 10 NUT2 YPR168W P9325.2 MED10 Mediator complex subunit 10 Negative regulator of URS2 protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNGNSTNNEQLQQELATTQDQVASIIESFVELGVSIYDFPGTPEATKGMITNLQRNVDRLYKLNVRSNDPQSSLSKVDIPLEVVQYIEDGRNPDIYTREFVEAIRRSNQYQRGKMHGLKQLRDSLADKIVDEFPELKEPVEDIIKRTSPIDNVSNTH 0E77A43A5222E862 0E77A43A5222E862 med6_yeast Mediator of RNA polymerase II transcription subunit 6 MTR32 YHR058C Mediator complex subunit 6 MED6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNVTPLDELQWKSPEWIQVFGLRTENVLDYFAESPFFDKTSNNQVIKMQRQFSQLNDPNAAVNMTQNIMTLPDGKNGNLEEEFAYVDPARRQILFKYPMYMQLEEELMKLDGTEYVLSSVREPDFWVIRKQRRTNNSGVGSAKGPEIIPLQDYYIIGANIYQSPTIFKIVQSRLMSTSYHLNSTLESLYDLIEFQPSQGVHYKVPTDTSTTATAATNGNNAGGGSNKSSVRPTGGANMATVPSTTNVNMTVNTMGTGGQTIDNGTGRTGNGNMGITTEMLDKLMVTSIRSTPNYI B84E87DCC2737849 B84E87DCC2737849 ufo1_yeast Ubiquitin ligase complex F-box protein UFO1 UFO1 YML088W protein protein yeast Saccharomyces cerevisiae Baker's yeast MERPGLVLQDLPPEILINIFSHLDEKDLFTLQELSTHFRNLIHDEELWKNLFKSRVHTTHFPTFSQSSKFSVEYIERTRGLHHWQHNKAIRTKYTIIPTRNWDQPSIERIVFDYPRVAAYNDGTITILQLQNHKRQKKFKKLIYIPCTTPQGCSTMDFNINAAVFGRFDGRVFGKLLSNKSYLTPVMEFTGRHSAGVTAICNSESWDTSREDWSVSGSENGEIIWWCENKLVKMWKVSNRVIWKLAFFKDWTLIMDDEKLYIIHQMQELHSIDIPKDLDEQPMRVRFFKMDFGSMTLVLADLNNVYTISVNPNGNFGNLRKLEMPEQICAVEIDEKTSQREQNWQFAGDDGCYISLLTTQNTLYIINIRDLSSSGLKVQCKISFDEQVYVSQVTNLIVVVALPNVLQILNAMTGELIKTVLKTEKFPEFLKVSQDKIIMGSGNVLNYLKFVSSDSKKHHHSTKGKNTVSNKWNETLNTELQYYDEDEDLRRKRQSEISRLIDAYGGDLELSGDTDEENDIQLRIALLESQEAQARNQAEAGEPVGDDEDEQLRRALEESQLIYETQTNSSANHGNNTNDEIDEDDEEFLRAIRQSRVEDERRRHLRNHTTGRRNGPLSDDNFATYGAAESSERTSTENTIGSSVGVDASNNVDEDLQLAIALSLSEIN 10CA467CF9417FBC 10CA467CF9417FBC med21_human Mediator of RNA polymerase II transcription subunit 21 SRB7 MED21 Mediator complex subunit 21 RNA polymerase II holoenzyme component SRB7 SURB7 protein protein human Homo sapiens Human MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQTAINKDQPANPTEEYAQLFAALIARTAKDIDVLIDSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQSLPDS DIP protein Q13503 original sequence version: 128 DIP protein Q13503 original sequence version: 100 F786169620EDC126 p63208-1 S-phase kinase-associated protein 1 SKP1 EMC19 OCP2 SKP1A TCEB1L Cyclin-A/CDK2-associated protein p19 Organ of Corti protein 2 Organ of Corti protein II RNA polymerase II elongation factor-like protein SIII p19skp1 Transcription elongation factor B polypeptide 1-like protein protein human Homo sapiens Human MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK DIP protein P63208-1 original sequence version: 128 DIP protein P63208-1 original sequence version: 116 DIP protein P63208 original sequence version: 76 DIP protein P63208-1 original sequence version: 76 DIP protein P63208 original sequence version: 104 DIP protein P63208 original sequence version: 127 DIP protein P63208 original sequence version: 123 DIP protein P63208 original sequence version: 61 DIP protein P63208 original sequence version: 91 DIP protein P63208 original sequence version: 115 DIP protein P63208 original sequence version: 94 DIP protein P63208 original sequence version: 75 DIP protein P63208 original sequence version: 85 C794D62AFB75528A gal80_yeast Galactose/lactose metabolism regulatory protein GAL80 GAL80 YM9958.12 YM9827.01 YML051W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDYNKRSSVSTVPNAAPIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKIETSIATIQRLKLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQELIDERGNRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSFKGGKPTKKFTKNLVIDIHGTKGDLKLEGDAGFAEISNLVLYYSGTRANDFPLANGQQAPLDPGYDAGKEIMEVYHLRNYNAIVGNIHRLYQSISDFHFNTKKIPELPSQFVMQGFDFEGFPTLMDALILHRLIESVYKSNMMGSTLNVSNISHYSL 1492473684F3894C 1492473684F3894C med22_yeast Mediator of RNA polymerase II transcription subunit 22 SRB6 YBR253W YBR1721 MED22 Mediator complex subunit 22 Suppressor of RNA polymerase B 6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNQALYEKLEQTRTILSVKLAELINMTTIADRNDDDEGSFAQENSELAVATTSVMMVNNQTMQLIKNVQDLLILTRSIKEKWLLNQIPVTEHSKVTRFDEKQIEELLDNCIETFVAEKTT 7703E4FAE101A31F 7703E4FAE101A31F snf1_yeast Carbon catabolite-derepressing protein kinase SNF1 CAT1 CCR1 GLC2 PAS14 Sucrose nonfermentating protein 1 D8035.20 YDR477W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSNNNTNTAPANANSSHHHHHHHHHHHHHGHGGSNSTLNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKVDLPEYLLPPDLKPHPEEENENNDSKKDGSSPDNDEIDDNLVNILSSTMGYEKDEIYESLESSEDTPAFNEIRDAYMLIKENKSLIKDMKANKSVSDELDTFLSQSPPTFQQQSKSHQKSQVDHETAKQHARRMASAITQQRTYHQSPFMDQYKEEDSTVSILPTSLPQIHRANMLAQGSPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEEDLWTIKLRWKYDIGNKTNTNEKIPDLMKMVIQLFQIETNNYLVDFKFDGWESSYGDDTTVSNISEDEMSTFSAYPFLHLTTKLIMELAVNSQSN F5C63565C986C4E3 F5C63565C986C4E3 ssn8_yeast RNA polymerase II holoenzyme cyclin-like subunit SSN8 SRB11 GIG3 YNL025C N2805 NUT9 UME3 Suppressor of RNA polymerase B 11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGSFWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQSITKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYMLVTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTEFEFYLLEELESYLIVHHPYQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFITISIHGKPTKGSSLASAASEAIRDPKNSSSPVQIAFNRFMAESLVDLEEVMDTIQEQITLYDHWDKYHEQWIKFLLHTLYLRPASAI 2BA16A3374CCF207 2BA16A3374CCF207 med6_human Mediator of RNA polymerase II transcription subunit 6 ARC33 MED6 Mediator complex subunit 6 Activator-recruited cofactor 33 kDa component Renal carcinoma antigen NY-REN-28 protein protein human Homo sapiens Human MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEQDKVRPKAKRKEEPSSIFQRQRVDALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNVQQTVSAKGPPEKRMRLQ DIP protein O75586 original sequence version: 116 DIP protein O75586 original sequence version: 100 9B173626F583B48B skp1_yeast Suppressor of kinetochore protein 1 SKP1 CBF3D YDR328C D9798.14 Centromere DNA-binding protein complex CBF3 subunit D E3 ubiquitin ligase complex SCF subunit SKP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSKDNNNGDDDDEDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDSWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIRRENEWAEDR 746DDE6470A69432 746DDE6470A69432 med21_yeast Mediator of RNA polymerase II transcription subunit 21 SRB7 YDR308C D9740.17 MED21 Mediator complex subunit 21 RNAPII complex component SRB7 Suppressor of RNA polymerase B 7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTDRLTQLQICLDQMTEQFCATLNYIDKNHGFERLTVNEPQMSDKHATVVPPEEFSNTIDELSTDIILKTRQINKLIDSLPGVDVSAEEQLRKIDMLQKKLVEVEDEKIEAIKKKEKLLRHVDSLIEDFVDGIANSKKST C5B3474AF8DD662A C5B3474AF8DD662A ubiq_yeast Ubiquitin UBI1 RPL40A YIL148W UBI2 RPL40B YKR094C UBI3 RPS31 YLR167W L9470.14 UBI4 SCD2 YLL039C protein protein yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG obsolete protein 9AC936269D38403E mdm30_yeast Mitochondrial distribution and morphology protein 30 MDM30 YLR368W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTKRRNLFMVGSSFTIDHLPPEIWLCISKLVGTSDLHNLCLINRRLYLTITSDEIWKRRCYDRWINRESLDILTGNDYDSIPVSQWYSYYLRRAKWENKIFCLLWGLTEETNPQHFREKYLHILQFRHYKLATFLHRIIKQGYIPDKRPLDLITYANYLLKNVRHKYVFPLFYPTNAAELKNLNNMASRDAEMIYLRLSAIDTSFDDLLDAREFILNGICSDLLQKYKKIEEFLKLRPVTRVSKLISISTDYLDCFTQPHDSVGQTNDRATGRELHREDFMLLRVYSREGRGYKTIILAIIQAITKRYNVDSYLARDHLVVSEPDFPDGRAFVTVNEDFQPYIFDKEDLLSVWSNNFHNAENFESTVLPALLEPISIQHLLTEFFRELLRCKPRPFEGYPNRAHGLRDMFPYGKVEVPRDVTMYFAFIYDLFDGMFESGMTSLRGQMLRDLLNYVNANNFGDLNIIIGQNALKEPNDCWSNKRDYVLLDDNNKIGYFYTDIETEDTLCALNQYEVDGKVFITTIDILGDIRVRLAEGLTPFQGDNDKLWESFSSVVPRTDWGLFFKGYDKERRRMQLNPYIEEKLSNLANDEQPLHNL CECDC2E2C7EDBB06 CECDC2E2C7EDBB06 gal80-mdm30-1 6 35 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cul1-med6-1 4 21 unspecified role unspecified role bait bait human Homo sapiens Human 31 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association gal80-ufo1-1 12 24 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association med6-cul1-1 19 21 unspecified role unspecified role prey prey human Homo sapiens Human 31 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association skp1-med21-1 9 25 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association med21-skp1-1 15 25 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association skp1-med6-1 5 32 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 31 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association ub-gal80-1 8 34 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association snf1-med6-1 18 23 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association snf1-med10-1 1 22 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association med21-skp1-2 14 25 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association srb7-skp1-1 16 33 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-40 Region 1-40 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 32 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association gal80-skp1-1 2 32 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association med21-skp1-3 13 25 unspecified role unspecified role bait bait human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association snf1-srb6-1 10 28 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association srb7-skp1-2 7 33 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 32 unspecified role unspecified role prey prey P52286:p.[Val90Ala;Glu129Ala] V90A/E129A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'V90A/E129A'. Wed May 02 19:56:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val90ala,glu129ala' Tue Jun 30 20:18:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val90Ala;Glu129Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association gal80-das1-1 3 20 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association snf1-srb11-1 11 30 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association med21-skp1-4 17 25 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association