DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Exploiting a natural conformational switch to engineer an interleukin-2 'superkine'. Exploiting a natural conformational switch to engineer an interleukin-2 'superkine'. Nature 2012 imex curation Levin AM., Bates DL., Ring AM., Krieg C., Lin JT., Su L., Moraga I., Raeber ME., Bowman GR., Novick P., Pande VS., Fathman CG., Boyman O., Garcia KC. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Levin AM., Bates DL., Ring AM., Krieg C., Lin JT., Su L., Moraga I., Raeber ME., Bowman GR., Novick P., Pande VS., Fathman CG., Boyman O., Garcia KC. DIP original experiment: DIP-249557X Nature 2012 IMEx Exploiting a natural conformational switch to engineer an interleukin-2 'superkine'. Exploiting a natural conformational switch to engineer an interleukin-2 'superkine'. Exploiting a natural conformational switch to engineer an interleukin-2 'superkine'. Nature 2012 imex curation Levin AM., Bates DL., Ring AM., Krieg C., Lin JT., Su L., Moraga I., Raeber ME., Bowman GR., Novick P., Pande VS., Fathman CG., Boyman O., Garcia KC. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Levin AM., Bates DL., Ring AM., Krieg C., Lin JT., Su L., Moraga I., Raeber ME., Bowman GR., Novick P., Pande VS., Fathman CG., Boyman O., Garcia KC. DIP original experiment: DIP-249559X Nature 2012 IMEx Exploiting a natural conformational switch to engineer an interleukin-2 'superkine'. Exploiting a natural conformational switch to engineer an interleukin-2 'superkine'. Exploiting a natural conformational switch to engineer an interleukin-2 'superkine'. Nature 2012 imex curation Levin AM., Bates DL., Ring AM., Krieg C., Lin JT., Su L., Moraga I., Raeber ME., Bowman GR., Novick P., Pande VS., Fathman CG., Boyman O., Garcia KC. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Levin AM., Bates DL., Ring AM., Krieg C., Lin JT., Su L., Moraga I., Raeber ME., Bowman GR., Novick P., Pande VS., Fathman CG., Boyman O., Garcia KC. DIP original experiment: DIP-249558X Nature 2012 IMEx Exploiting a natural conformational switch to engineer an interleukin-2 'superkine'. p31785-1 Cytokine receptor common subunit gamma IL2RG Interleukin-2 receptor subunit gamma gammaC p64 protein protein human Homo sapiens Human MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET DIP protein P31785-1 original sequence version: 174 DIP protein P31785 original sequence version: 147 il2_human Interleukin-2 T-cell growth factor IL2 protein protein human Homo sapiens Human MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFCQSIISTLT DIP protein P60568 original sequence version: 128 DIP protein P60568 original sequence version: 131 DIP protein P60568 original sequence version: 104 59E2F40F25860F84 il2rb_human Interleukin-2 receptor subunit beta IL2RB High affinity IL-2 receptor subunit beta p70-75 Interleukin-15 receptor subunit beta IL15RB protein protein human Homo sapiens Human MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDTIPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDVQKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCTFPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVPDLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQELQGQDPTHLV DIP protein P14784 original sequence version: 170 DIP protein P14784 original sequence version: 147 1A76FA1936BB7EE6 il2rb-il2-1 1 5 unspecified role unspecified role prey prey Mature protein Region 21-153 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P60568:p.Leu105Val L105V mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L V This feature has been corrected as a result of our quality control procedures. The original label was 'L105V'. Wed May 02 14:36:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu105val' Tue Jun 30 18:01:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu105Val' P60568:p.[Arg101Ile;Leu105Val] R101I/L105V mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L V certain certain sequence position certain certain certain sequence position certain R I This feature has been corrected as a result of our quality control procedures. The original label was 'R101I/L105V'. Wed May 02 18:32:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg101ile,leu105val' Tue Jun 30 17:08:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg101Ile;Leu105Val]' P60568:p.[Gln94Asn;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile109Val;Ile112Phe] Q94N/L100F/R101D/L105V/I106V/I109V/I112F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q N certain certain sequence position certain certain certain sequence position certain I F certain certain sequence position certain certain certain sequence position certain I V certain certain sequence position certain certain certain sequence position certain I V certain certain sequence position certain certain certain sequence position certain L V certain certain sequence position certain certain certain sequence position certain R D certain certain sequence position certain certain certain sequence position certain L F This feature has been corrected as a result of our quality control procedures. The original label was 'Q94N/L100F/R101D/L105V/I106V/I109V/I112F'. Wed May 02 18:18:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln94asn,leu100phe,arg101asp,leu105val,ile106val,ile109val,ile112phe' Tue Jun 30 19:28:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln94Asn;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile109Val;Ile112Phe]' P60568:p.[Pro85His;Gln94Asn;Leu100Val;Arg101Thr;Leu105Val;Ile106Val;Ile112Phe] P85H/Q94N/L100V/R101T/L105V/I106V/I112F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q N certain certain sequence position certain certain certain sequence position certain P H certain certain sequence position certain certain certain sequence position certain I F certain certain sequence position certain certain certain sequence position certain I V certain certain sequence position certain certain certain sequence position certain L V certain certain sequence position certain certain certain sequence position certain R T certain certain sequence position certain certain certain sequence position certain L V This feature has been corrected as a result of our quality control procedures. The original label was 'P85H/Q94N/L100V/R101T/L105V/I106V/I112F'. Wed May 02 16:16:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro85his,gln94asn,leu100val,arg101thr,leu105val,ile106val,ile112phe' Tue Jun 30 16:48:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro85His;Gln94Asn;Leu100Val;Arg101Thr;Leu105Val;Ile106Val;Ile112Phe]' P60568:p.[Gln94His;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe] Q94H/L100F/R101D/L105V/I106V/I112F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q H certain certain sequence position certain certain certain sequence position certain I F certain certain sequence position certain certain certain sequence position certain I V certain certain sequence position certain certain certain sequence position certain L V certain certain sequence position certain certain certain sequence position certain R D certain certain sequence position certain certain certain sequence position certain L F This feature has been corrected as a result of our quality control procedures. The original label was 'Q94H/L100F/R101D/L105V/I106V/I112F'. Wed May 02 18:41:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln94his,leu100phe,arg101asp,leu105val,ile106val,ile112phe' Tue Jun 30 18:03:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln94His;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe]' P60568:p.[Gln94Ser;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe] Q94S/L100F/R101D/L105V/I106V/I112F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q S certain certain sequence position certain certain certain sequence position certain I F certain certain sequence position certain certain certain sequence position certain I V certain certain sequence position certain certain certain sequence position certain L V certain certain sequence position certain certain certain sequence position certain R D certain certain sequence position certain certain certain sequence position certain L F This feature has been corrected as a result of our quality control procedures. The original label was 'Q94S/L100F/R101D/L105V/I106V/I112F'. Wed May 02 19:42:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln94ser,leu100phe,arg101asp,leu105val,ile106val,ile112phe' Tue Jun 30 17:27:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln94Ser;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe]' P60568:p.[Gln94Asn;Lys96Ile;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe] Q94N/K96I/L100F/R101D/L105V/I106V/I112F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K I certain certain sequence position certain certain certain sequence position certain Q N certain certain sequence position certain certain certain sequence position certain I F certain certain sequence position certain certain certain sequence position certain I V certain certain sequence position certain certain certain sequence position certain L V certain certain sequence position certain certain certain sequence position certain R D certain certain sequence position certain certain certain sequence position certain L F This feature has been corrected as a result of our quality control procedures. The original label was 'Q94N/K96I/L100F/R101D/L105V/I106V/I112F'. Wed May 02 19:19:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln94asn,lys96ile,leu100phe,arg101asp,leu105val,ile106val,ile112phe' Tue Jun 30 15:39:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln94Asn;Lys96Ile;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe]' P60568:p.[Gln94Ser;Arg101Thr;Leu105Val;Ile112Phe] Q94S/R101T/L105V/I112F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q S certain certain sequence position certain certain certain sequence position certain I F certain certain sequence position certain certain certain sequence position certain L V certain certain sequence position certain certain certain sequence position certain R T This feature has been corrected as a result of our quality control procedures. The original label was 'Q94S/R101T/L105V/I112F'. Wed May 02 17:29:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln94ser,arg101thr,leu105val,ile112phe' Tue Jun 30 19:49:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln94Ser;Arg101Thr;Leu105Val;Ile112Phe]' P60568:p.[Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe] L100F/R101D/L105V/I106V/I112F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I F certain certain sequence position certain certain certain sequence position certain I V certain certain sequence position certain certain certain sequence position certain L V certain certain sequence position certain certain certain sequence position certain R D certain certain sequence position certain certain certain sequence position certain L F This feature has been corrected as a result of our quality control procedures. The original label was 'L100F/R101D/L105V/I106V/I112F'. Wed May 02 15:12:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu100phe,arg101asp,leu105val,ile106val,ile112phe' Tue Jun 30 18:13:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe]' trini Trichoplusia ni (Cabbage looper) Cabbage looper 6 unspecified role unspecified role bait bait Ectodomain Region 27-240 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction il2-il2rb-1 3 5 unspecified role unspecified role unspecified role unspecified role Mature protein Region 21-153 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P60568:p.[Gln94His;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe] Q94H/L100F/R101D/L105V/I106V/I112F mutation mutation certain certain sequence position certain certain certain sequence position certain Q H certain certain sequence position certain certain certain sequence position certain I F certain certain sequence position certain certain certain sequence position certain I V certain certain sequence position certain certain certain sequence position certain L V certain certain sequence position certain certain certain sequence position certain R D certain certain sequence position certain certain certain sequence position certain L F This feature has been corrected as a result of our quality control procedures. The original label was 'Q94H/L100F/R101D/L105V/I106V/I112F'. Wed May 02 15:06:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln94his,leu100phe,arg101asp,leu105val,ile106val,ile112phe' Tue Jun 30 15:56:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln94His;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe]' P60568:p.[Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe] L100F/R101D/L105V/I106V/I112F mutation mutation certain certain sequence position certain certain certain sequence position certain I F certain certain sequence position certain certain certain sequence position certain I V certain certain sequence position certain certain certain sequence position certain L V certain certain sequence position certain certain certain sequence position certain R D certain certain sequence position certain certain certain sequence position certain L F This feature has been corrected as a result of our quality control procedures. The original label was 'L100F/R101D/L105V/I106V/I112F'. Wed May 02 16:09:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu100phe,arg101asp,leu105val,ile106val,ile112phe' Tue Jun 30 18:04:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe]' trini Trichoplusia ni (Cabbage looper) Cabbage looper 6 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 27-240 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction il2-il2rb-2 2 4 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 56-254 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 5 unspecified role unspecified role unspecified role unspecified role Mature protein Region 21-153 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P60568:p.[Gln94His;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe] Q94H/L100F/R101D/L105V/I106V/I112F mutation mutation certain certain sequence position certain certain certain sequence position certain Q H certain certain sequence position certain certain certain sequence position certain I F certain certain sequence position certain certain certain sequence position certain I V certain certain sequence position certain certain certain sequence position certain L V certain certain sequence position certain certain certain sequence position certain R D certain certain sequence position certain certain certain sequence position certain L F This feature has been corrected as a result of our quality control procedures. The original label was 'Q94H/L100F/R101D/L105V/I106V/I112F'. Wed May 02 17:39:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln94his,leu100phe,arg101asp,leu105val,ile106val,ile112phe' Tue Jun 30 17:12:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln94His;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe]' trini Trichoplusia ni (Cabbage looper) Cabbage looper 6 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 27-240 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction