DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Lipophilic analogs of zoledronate and risedronate inhibit Plasmodium geranylgeranyl diphosphate synthase (GGPPS) and exhibit potent antimalarial activity. Lipophilic analogs of zoledronate and risedronate inhibit Plasmodium geranylgeranyl diphosphate synthase (GGPPS) and exhibit potent antimalarial activity. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation No JH., de Macedo Dossin F., Zhang Y., Liu YL., Zhu W., Feng X., Yoo JA., Lee E., Wang K., Hui R., Freitas-Junior LH., Oldfield E. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined No JH., de Macedo Dossin F., Zhang Y., Liu YL., Zhu W., Feng X., Yoo JA., Lee E., Wang K., Hui R., Freitas-Junior LH., Oldfield E. DIP original experiment: DIP-251555X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Lipophilic analogs of zoledronate and risedronate inhibit Plasmodium geranylgeranyl diphosphate synthase (GGPPS) and exhibit potent antimalarial activity. a5k4u6_plavs PVX_092040 protein protein Plasmodium vivax (strain Salvador I) Plasmodium vivax (strain Salvador I) MKETNSEEADSGLAFFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNNRGILVILIYEYVKNRDINSSEWEKAACLAWCIEILQAAFLVADDIMDKGETRRNKYCWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFRDATLKTIIGQHLDTNIFSDKYSDAHREIDVNNINVPEQPVININMINFGVYKNIVIHKTAYYSFFLPIVCGMLLAGIAVDNLIYKKIEDISMLMGEYFQIHDDYLDIFGDSTKTGKVGSDIQNNKLTWPLIKTFELCSEPDKIKIVKNYGKNNLACVKVIDSLYEQYKIRKHYESYEKAQKAKILSAINELHHEGIEYVLKYLLEILFTGV DIP protein A5K4U6 original sequence version: 41 a5k4u6_plavs-1 1 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction