DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250873X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250872X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250869X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250865X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250878X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250876X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250871X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250877X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250870X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250881X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250874X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250867X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250866X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250880X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250875X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250868X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Nature structural & molecular biology 2012 imex curation Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250879X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. sap18_human Histone deacetylase complex subunit SAP18 18 kDa Sin3-associated polypeptide Sin3-associated polypeptide p18 Cell growth-inhibiting gene 38 protein 2HOR0202 SAP18 GIG38 protein protein human Homo sapiens Human MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRMRPY DIP protein O00422 original sequence version: 157 DIP protein O00422 original sequence version: 105 C7E479FFE9CA5774 sap18_mouse Histone deacetylase complex subunit SAP18 Sap18 18 kDa Sin3-associated polypeptide Sin3-associated polypeptide p18 protein protein mouse Mus musculus Mouse MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPSSGRMRPY DIP protein O55128 original sequence version: 90 68FE63E6EAD04E6F q9ukv3-1 Apoptotic chromatin condensation inducer in the nucleus ACIN1 ACINUS KIAA0670 L protein protein human Homo sapiens Human MWRRKHPRTSGGTRGVLSGNRGVEYGSGRGHLGTFEGRWRKLPKMPEAVGTDPSTSRKMAELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVKRLKGALMLENLQKHSTPHAAFQPNSQIGEEMSQNSFIKQYLEKQQELLRQRLEREAREAAELEEASAESEDEMIHPEGVASLLPPDFQSSLERPELELSRHSPRKSSSISEEKGDSDDEKPRKGERRSSRVRQARAAKLSEGSQPAEEEEDQETPSRNLRVRADRNLKTEEEEEEEEEEEEDDEEEEGDDEGQKSREAPILKEFKEEGEEIPRVKPEEMMDERPKTRSQEQEVLERGGRFTRSQEEARKSHLARQQQEKEMKTTSPLEEEEREIKSSQGLKEKSKSPSPPRLTEDRKKASLVALPEQTASEEETPPPLLTKEASSPPPHPQLHSEEEIEPMEGPAPAVLIQLSPPNTDADTRELLVSQHTVQLVGGLSPLSSPSDTKAESPAEKVPEESVLPLVQKSTLADYSAQKDLEPESDRSAQPLPLKIEELALAKGITEECLKQPSLEQKEGRRASHTLLPSHRLKQSADSSSSRSSSSSSSSSRSRSRSPDSSGSRSHSPLRSKQRDVAQARTHANPRGRPKMGSRSTSESRSRSRSRSRSASSNSRKSLSPGVSRDSSTSYTETKDPSSGQEVATPPVPQLQVCEPKERTSTSSSSVQARRLSQPESAEKHVTQRLQPERGSPKKCEAEEAEPPAATQPQTSETQTSHLPESERIHHTVEEKEEVTMDTSENRPENDVPEPPMPIADQVSNDDRPEGSVEDEEKKESSLPKSFKRKISVVSATKGVPAGNSDTEGGQPGRKRRWGASTATTQKKPSISITTESLKSLIPDIKPLAGQEAVVDLHADDSRISEDETERNGDDGTHDKGLKICRTVTQVVPAEGQENGQREEEEEEKEPEAEPPVPPQVSVEVALPPPAEHEVKKVTLGDTLTRRSISQQKSGVSITIDDPVRTAQVPSPPRGKISNIVHISNLVRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWPQSNPKFLCADYAEQDELDYHRGLLVDRPSETKTEEQGIPRPLHPPPPPPVQPPQHPRAEQREQERAVREQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAERAKEREKRRKEQEEEEQKEREKEAERERNRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGRERDRRDTKRHSRSRSRSTPVRDRGGRR DIP protein Q9UKV3-1 original sequence version: 111 mint DCCBF310A4680691 q9ukv3-2 Apoptotic chromatin condensation inducer in the nucleus S' ACIN1 ACINUS KIAA0670 protein protein human Homo sapiens Human MSPADRCRSANTIEPATTSSLALFLLLQRDQSSRTRGLPEEKEEVTMDTSENRPENDVPEPPMPIADQVSNDDRPEGSVEDEEKKESSLPKSFKRKISVVSATKGVPAGNSDTEGGQPGRKRRWGASTATTQKKPSISITTESLKSLIPDIKPLAGQEAVVDLHADDSRISEDETERNGDDGTHDKGLKICRTVTQVVPAEGQENGQREEEEEEKEPEAEPPVPPQVSVEVALPPPAEHEVKKVTLGDTLTRRSISQQKSGVSITIDDPVRTAQVPSPPRGKISNIVHISNLVRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWPQSNPKFLCADYAEQDELDYHRGLLVDRPSETKTEEQGIPRPLHPPPPPPVQPPQHPRAEQREQERAVREQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAERAKEREKRRKEQEEEEQKEREKEAERERNRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGRERDRRDTKRHSRSRSRSTPVRDRGGRR DIP protein Q9UKV3-2 original sequence version: 111 2E994FB0FA922F4C pinin_human Pinin 140 kDa nuclear and cell adhesion-related phosphoprotein Domain-rich serine protein Melanoma metastasis clone A protein Desmosome-associated protein SR-like protein Nuclear protein SDK3 PNN DRS MEMA protein protein human Homo sapiens Human MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGSLLLRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQESDPEDDDVKKPALQSSVVATSKERTRRDLIQDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATERQKRRQEIEQKLEVQAEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRNEEQKAEQEEGKVAQREEELEETGNQHNDVEIEEAGEEEEKEIAIVHSDAEKEQEEEEQKQEMEVKMEEETEVRESEKQQDSQPEEVMDVLEMVENVKHVIADQEVMETNRVESVEPSENEASKELEPEMEFEIEPDKECKTLSPGKENVSALDMEKESEEKEEKESEPQPEPVAQPQPQSQPQLQLQSQSQPVLQSQPPSQPEDLSLAVLQPTPQVTQEQGHLLPERKDFPVESVKLTEVPVEPVLTVHPESKSKTKTRSRSRGRARNKTSKSRSRSSSSSSSSSSSTSSSSGSSSSSGSSSSRSSSSSSSSTSGSSSRDSSSSTSSSSESRSRSRGRGHNRDRKHRRSVDRKRRDTSGLERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSRSGKRSSRSERDRKSDRKDKRR DIP protein Q9H307 original sequence version: 79 DIP protein Q9H307-1 original sequence version: 90 1F24D3F12E053C8F q9vj12_drome hkl Acn acn CG10437 Ba Dmel\CG10473 dAcn dacn l(2)37Ba Dmel_CG10473 CG10473 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MRRRSERKKSSSPAPVPVAVARRSRRSRKVSENEKTEVETPVVAQNNEAECPKVPPASQEINEARASSEERAGSGASPVRRSRGSRTTPRKRTESKGGDKKVDTIPEEEPENGKDVEKDAVEEEKTVAPPAANESESEDRAKTEDQQAQDDESCAEPAVVKDDDVEKEDLKPQQEVPTSTDDDTKQSEPEQEVKVPSPSSKDEEHLKTTSDVLDIQTEEVDERDEEASAPAERRETKKRHKEQIKEQQPAEEEEHKENHKQIDENPEQIHDEPADLSNDKHDPCLNSSATNTTGAPVLQQQRSVRKRKWLTNKKSSDRTPPVLAISTDSLKNIIADVVQPVPLSDVQLESSSEEEGLVTSDRDSERSASPAPPSEASKDRDNKGNTANTCDTTAEASADNEGAGAAPPAAADTVSAQVSLSKATVSTAAPHIVRDPSPARNRASHVLYITNLVRPFTVLQLKGLLARTGKIVEEDGFWIDRIKSKCYVAYSTEDEAIETRHALHGVRWPVSNPKCLNVDFGSRTDMDRAILSTKDEAPRYGQENTRDNQQSGNAWSRLEPSDKKPARPVREWDVGKKEPSDHDKHSNDRRRDSKDRLDSRSRDAERAGQERKRSRDREGRGRDRERERLDRNAHARSRSGSPASKTKKENEPPIRLLDDLFRKTKGTPCIYWLPLTPEAIAEKEAFRQKRIEEHKLRIKEREERQKEREKDRDRQRETRRNRSNERRRSRSRERERRRY DIP protein Q9VJ12 original sequence version: 83 DB6D6D46C32E9B26 q15287-1 RNA-binding protein with serine-rich domain 1 SR-related protein LDC2 RNPS1 LDC2 protein protein human Homo sapiens Human MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRDKTRKRRSASSGSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSSSGSPSPSRRRHDNRRRSRSKSKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVLAPWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVRRRSRSPGRRRHRSRSSSNSSR DIP protein Q15287-1 original sequence version: 114 pnn-rnps1-3 16 24 unspecified role unspecified role unspecified role unspecified role RRM domain Region 159-244 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 22 unspecified role unspecified role unspecified role unspecified role Region 221-284 Region 221-284 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction sap18-pnn-1 4 18 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range This tag was used for western blot detection. human Homo sapiens Human 24 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 22 unspecified role unspecified role prey prey Region 221-284 Region 221-284 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association acn-rnps1-1 17 19 unspecified role unspecified role unspecified role unspecified role Region 6-143 Region 6-143 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role Region 617-710 Region 617-710 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role RRM domain Region 159-244 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association acin1-rnps1-1 7 18 unspecified role unspecified role prey prey ecolx Escherichia coli 24 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 21 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper association association sap18-acin1-1 15 18 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 24 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 21 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper association association rnps1-acin1-1 5 20 unspecified role unspecified role prey prey Region 1171-1250 Region 1171-1250 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role prey prey Region 6-143 Region 6-143 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 24 unspecified role unspecified role bait bait CBP-tag CBP-tag cam tag calmodulin binding protein tag cam tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association sap18-acin1-2 3 21 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 18 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range This tag was used for western blot detection. human Homo sapiens Human 24 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association rnps1-acn-1 6 19 unspecified role unspecified role prey prey Region 6-143 Region 6-143 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role prey prey Region 617-710 Region 617-710 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 24 unspecified role unspecified role bait bait RRM domain Region 159-244 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association acin1-rnps1-2 2 24 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 21 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction sap18-pnn-2 13 18 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range This tag was used for western blot detection. human Homo sapiens Human 22 unspecified role unspecified role prey prey Region 221-284 Region 221-284 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association rnps1-acin1-2 8 20 unspecified role unspecified role prey prey Region 1171-1250 Region 1171-1250 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role prey prey ecolx Escherichia coli 24 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper association association rnps1-acin1-3 1 18 unspecified role unspecified role prey prey ecolx Escherichia coli 24 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 21 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper association association pnn-rnps1-4 9 24 unspecified role unspecified role prey prey RRM domain Region 159-244 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 22 unspecified role unspecified role bait bait Region 221-284 Region 221-284 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association acn-rnps1-2 10 19 unspecified role unspecified role unspecified role unspecified role Region 14-143 Region 14-143 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role Region 648-688 Region 648-688 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role RRM domain Region 159-244 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pnn-rnps1-5 12 19 unspecified role unspecified role unspecified role unspecified role Region 6-143 Region 6-143 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role RRM domain Region 159-244 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 22 unspecified role unspecified role unspecified role unspecified role Region 221-284 Region 221-284 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association acn-rnps1-3 14 23 unspecified role unspecified role unspecified role unspecified role Region 617-710 Region 617-710 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role RRM domain Region 159-244 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction rnps1-acin1-4 11 24 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 21 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction