DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Bacterial chemoreceptor arrays are hexagonally packed trimers of receptor dimers networked by rings of kinase and coupling proteins. Bacterial chemoreceptor arrays are hexagonally packed trimers of receptor dimers networked by rings of kinase and coupling proteins. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Briegel A., Li X., Bilwes AM., Hughes KT., Jensen GJ., Crane BR. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Briegel A., Li X., Bilwes AM., Hughes KT., Jensen GJ., Crane BR. DIP original experiment: DIP-251549X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Bacterial chemoreceptor arrays are hexagonally packed trimers of receptor dimers networked by rings of kinase and coupling proteins. chew_thema Chemotaxis protein CheW cheW TM_0701 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MKTLADALKEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITVKEGV 122A5EFEDFA3D561 q7dfa3_thema TM_0014 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MREREIVDKLTSAFFAENTIISFTSQLDEALTRKLRRMQRRIEEVKERFVNLNRLFQELVGDFQAKSDQLVSVIQDMEKISENIMEELKKSGTNVDQIVERVKEASSQIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVANEVQNLSNETNEVTKQIVEKAREILESSQRSLENLEFMANLFETVGKTLQNMVRFMENNVKLLQEVRNSLDTSKESLSEKSAEIDSATKVLEETAGGFTTINRVINSVITAQRKLKDLKI DIP protein Q7DFA3 original sequence version: 50 chea_thema Chemotaxis protein CheA cheA TM_0702 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MMEEYLGVFVDETKEYLQNLNDTLLELEKNPEDMELINEAFRALHTLKGMAGTMGFSSMAKLCHTLENILDKARNSEIKITSDLLDKIFAGVDMITRMVDKIVSEGSDDIGENIDVFSDTIKSFASSGKEKPSEIKNETETKGEEEHKGESTSNEEVVVLPEEVAHVLQEARNKGFKTFYIKVILKEGTQLKSARIYLVFHKLEELKCEVVRTIPSVEEIEEEKFENEVELFVISPVDLEKLSEALSSIADIERVIIKEVTAVTEESGAEKRTEKEEKTEKTEEKAERKKVISQTVRVDIEKLDNLMDLMGELVIARSRILETLKKYNIKELDESLSHLSRITLDLQNVVMKIRMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLTLAIIQALLVKVNNLVYAIPIANIDTILSISKEDIQRVQDRDVIVIRGEVIPVYRLWEVLQIEHKEELEEMEAVIVRVGNRKYGIVVDDLLGQDDIVIKSLGKVFSEVKEFSGAAILGDGSIALIINVSGIV F264398B88DA34E1 F264398B88DA34E1 chea-chew-7 1 3 unspecified role unspecified role unspecified role unspecified role Region 107-191 Region 107-191 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role Region 355-671 Region 355-671 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction