DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Familial focal segmental glomerulosclerosis (FSGS)-linked α-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors. Familial focal segmental glomerulosclerosis (FSGS)-linked α-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors. The Journal of biological chemistry 2012 imex curation Khurana S., Chakraborty S., Lam M., Liu Y., Su YT., Zhao X., Saleem MA., Mathieson PW., Bruggeman LA., Kao HY. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Khurana S., Chakraborty S., Lam M., Liu Y., Su YT., Zhao X., Saleem MA., Mathieson PW., Bruggeman LA., Kao HY. DIP original experiment: DIP-266766X The Journal of biological chemistry 2012 IMEx Familial focal segmental glomerulosclerosis (FSGS)-linked α-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors. Familial focal segmental glomerulosclerosis (FSGS)-linked α-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors. Familial focal segmental glomerulosclerosis (FSGS)-linked α-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors. The Journal of biological chemistry 2012 imex curation Khurana S., Chakraborty S., Lam M., Liu Y., Su YT., Zhao X., Saleem MA., Mathieson PW., Bruggeman LA., Kao HY. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Khurana S., Chakraborty S., Lam M., Liu Y., Su YT., Zhao X., Saleem MA., Mathieson PW., Bruggeman LA., Kao HY. DIP original experiment: DIP-266768X The Journal of biological chemistry 2012 IMEx Familial focal segmental glomerulosclerosis (FSGS)-linked α-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors. Familial focal segmental glomerulosclerosis (FSGS)-linked α-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors. Familial focal segmental glomerulosclerosis (FSGS)-linked α-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors. The Journal of biological chemistry 2012 imex curation Khurana S., Chakraborty S., Lam M., Liu Y., Su YT., Zhao X., Saleem MA., Mathieson PW., Bruggeman LA., Kao HY. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Khurana S., Chakraborty S., Lam M., Liu Y., Su YT., Zhao X., Saleem MA., Mathieson PW., Bruggeman LA., Kao HY. DIP original experiment: DIP-266769X The Journal of biological chemistry 2012 IMEx Familial focal segmental glomerulosclerosis (FSGS)-linked α-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors. Familial focal segmental glomerulosclerosis (FSGS)-linked α-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors. Familial focal segmental glomerulosclerosis (FSGS)-linked α-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors. The Journal of biological chemistry 2012 imex curation Khurana S., Chakraborty S., Lam M., Liu Y., Su YT., Zhao X., Saleem MA., Mathieson PW., Bruggeman LA., Kao HY. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Khurana S., Chakraborty S., Lam M., Liu Y., Su YT., Zhao X., Saleem MA., Mathieson PW., Bruggeman LA., Kao HY. DIP original experiment: DIP-266770X The Journal of biological chemistry 2012 IMEx Familial focal segmental glomerulosclerosis (FSGS)-linked α-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors. Familial focal segmental glomerulosclerosis (FSGS)-linked α-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors. Familial focal segmental glomerulosclerosis (FSGS)-linked α-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors. The Journal of biological chemistry 2012 imex curation Khurana S., Chakraborty S., Lam M., Liu Y., Su YT., Zhao X., Saleem MA., Mathieson PW., Bruggeman LA., Kao HY. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Khurana S., Chakraborty S., Lam M., Liu Y., Su YT., Zhao X., Saleem MA., Mathieson PW., Bruggeman LA., Kao HY. DIP original experiment: DIP-266767X The Journal of biological chemistry 2012 IMEx Familial focal segmental glomerulosclerosis (FSGS)-linked α-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors. rara_human Retinoic acid receptor alpha RARA NR1B1 Nuclear receptor subfamily 1 group B member 1 protein protein human Homo sapiens Human MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP DIP protein P10276 original sequence version: 190 DIP protein P10276 original sequence version: 118 DIP protein P10276 original sequence version: 162 DIP protein P10276-1 original sequence version: 143 DIP protein P10276 original sequence version: 200 DIP protein P10276-1 original sequence version: 152 E8D1CF9A1E57CB99 actn4_human Alpha-actinin-4 ACTN4 Non-muscle alpha-actinin 4 protein protein human Homo sapiens Human MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKSFSTALYGESDL DIP protein O43707 original sequence version: 184 DIP protein O43707 original sequence version: 139 461580C3F22937D1 p37231-1 Peroxisome proliferator-activated receptor gamma PPARG NR1C3 Nuclear receptor subfamily 1 group C member 3 protein protein human Homo sapiens Human MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY DIP protein P37231-1 original sequence version: 114 DIP protein P37231 original sequence version: 153 DIP protein P37231 original sequence version: 212 DIP protein P37231-1 original sequence version: 162 o43707-1 Alpha-actinin-4 Non-muscle alpha-actinin 4 ACTN4 protein protein human Homo sapiens Human MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKSFSTALYGESDL DIP protein O43707-1 original sequence version: 184 rara-actn4-1 1 7 unspecified role unspecified role prey prey human Homo sapiens Human 6 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association rara-actn4-2 2 9 unspecified role unspecified role prey prey O43707-1:p.Lys255Glu K255E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K255E'. Wed May 02 16:31:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys255glu' Tue Jun 30 18:29:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys255Glu' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 6 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association actn4-pparg-1 4 8 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 9 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O43707-1:p.[Leu87Ala;Leu88Ala] L87A/L88A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L87A/L88A'. Wed May 02 19:35:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu87ala,leu88ala' Tue Jun 30 19:44:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu87Ala;Leu88Ala]' O43707-1:p.Thr259Ile T259I mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T I This feature has been corrected as a result of our quality control procedures. The original label was 'T259I'. Wed May 02 15:44:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr259ile' Tue Jun 30 19:22:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr259Ile' O43707-1:p.Ser262Pro S262P mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S P This feature has been corrected as a result of our quality control procedures. The original label was 'S262P'. Wed May 02 16:06:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser262pro' Tue Jun 30 16:42:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser262Pro' ecolx Escherichia coli physical association physical association actn4-rara-1 5 9 unspecified role unspecified role bait bait O43707-1:p.[Leu87Ala;Leu88Ala] L87A/L88A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L87A/L88A'. Wed May 02 17:39:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu87ala,leu88ala' Tue Jun 30 16:57:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu87Ala;Leu88Ala]' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O43707-1:p.Lys255Glu K255E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K255E'. Wed May 02 17:02:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys255glu' Tue Jun 30 17:03:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys255Glu' O43707-1:p.Thr259Ile T259I mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T I This feature has been corrected as a result of our quality control procedures. The original label was 'T259I'. Wed May 02 20:01:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr259ile' Tue Jun 30 19:12:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr259Ile' O43707-1:p.Ser262Pro S262P mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S P This feature has been corrected as a result of our quality control procedures. The original label was 'S262P'. Wed May 02 19:32:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser262pro' Tue Jun 30 16:02:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser262Pro' ecolx Escherichia coli 6 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association actn4-actn4-1 3 9 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 9 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association