DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Nature structural & molecular biology 2012 imex curation Ellisdon AM., Dimitrova L., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ellisdon AM., Dimitrova L., Hurt E., Stewart M. DIP original experiment: DIP-250835X Nature structural & molecular biology 2012 IMEx Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Nature structural & molecular biology 2012 imex curation Ellisdon AM., Dimitrova L., Hurt E., Stewart M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ellisdon AM., Dimitrova L., Hurt E., Stewart M. DIP original experiment: DIP-250837X Nature structural & molecular biology 2012 IMEx Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Nature structural & molecular biology 2012 imex curation Ellisdon AM., Dimitrova L., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Ellisdon AM., Dimitrova L., Hurt E., Stewart M. DIP original experiment: DIP-250842X Nature structural & molecular biology 2012 IMEx Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Nature structural & molecular biology 2012 imex curation Ellisdon AM., Dimitrova L., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ellisdon AM., Dimitrova L., Hurt E., Stewart M. DIP original experiment: DIP-250834X Nature structural & molecular biology 2012 IMEx Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Nature structural & molecular biology 2012 imex curation Ellisdon AM., Dimitrova L., Hurt E., Stewart M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Ellisdon AM., Dimitrova L., Hurt E., Stewart M. DIP original experiment: DIP-250843X Nature structural & molecular biology 2012 IMEx Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Nature structural & molecular biology 2012 imex curation Ellisdon AM., Dimitrova L., Hurt E., Stewart M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Ellisdon AM., Dimitrova L., Hurt E., Stewart M. DIP original experiment: DIP-250844X Nature structural & molecular biology 2012 IMEx Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Nature structural & molecular biology 2012 imex curation Ellisdon AM., Dimitrova L., Hurt E., Stewart M. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ellisdon AM., Dimitrova L., Hurt E., Stewart M. DIP original experiment: DIP-250836X Nature structural & molecular biology 2012 IMEx Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Nature structural & molecular biology 2012 imex curation Ellisdon AM., Dimitrova L., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Ellisdon AM., Dimitrova L., Hurt E., Stewart M. DIP original experiment: DIP-250840X Nature structural & molecular biology 2012 IMEx Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Nature structural & molecular biology 2012 imex curation Ellisdon AM., Dimitrova L., Hurt E., Stewart M. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Ellisdon AM., Dimitrova L., Hurt E., Stewart M. DIP original experiment: DIP-250841X Nature structural & molecular biology 2012 IMEx Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Nature structural & molecular biology 2012 imex curation Ellisdon AM., Dimitrova L., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Ellisdon AM., Dimitrova L., Hurt E., Stewart M. DIP original experiment: DIP-250838X Nature structural & molecular biology 2012 IMEx Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Nature structural & molecular biology 2012 imex curation Ellisdon AM., Dimitrova L., Hurt E., Stewart M. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Ellisdon AM., Dimitrova L., Hurt E., Stewart M. DIP original experiment: DIP-250839X Nature structural & molecular biology 2012 IMEx Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. sem1_human 26S proteasome complex subunit SEM1 C7orf76 SEM1 26S proteasome complex subunit DSS1 DSS1 Deleted in split hand/split foot protein 1 SHFDG1 SHFM1 Split hand/foot deleted protein 1 Split hand/foot malformation type 1 protein protein protein human Homo sapiens Human MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS DIP protein P60896 original sequence version: 95 DIP protein P60896 original sequence version: 81 0E0F58D2F3D9F723 ganp_human Germinal-center associated nuclear protein MCM3AP GANP KIAA0572 MAP80 80 kDa MCM3-associated protein MCM3 acetylating protein MCM3 acetyltransferase protein protein human Homo sapiens Human MNPTNPFSGQQPSAFSASSSNVGTLPSKPPFRFGQPSLFGQNSTLSGKSSGFSQVSSFPASSGVSHSSSVQTLGFTQTSSVGPFSGLEHTSTFVATSGPSSSSVLGNTGFSFKSPTSVGAFPSTSAFGQEAGEIVNSGFGKTEFSFKPLENAVFKPILGAESEPEKTQSQIASGFFTFSHPISSAPGGLAPFSFPQVTSSSATTSNFTFSKPVSSNNSLSAFTPALSNQNVEEEKRGPKSIFGSSNNSFSSFPVSSAVLGEPFQASKAGVRQGCEEAVSQVEPLPSLMKGLKRKEDQDRSPRRHGHEPAEDSDPLSRGDHPPDKRPVRLNRPRGGTLFGRTIQDVFKSNKEVGRLGNKEAKKETGFVESAESDHMAIPGGNQSVLAPSRIPGVNKEEETESREKKEDSLRGTPARQSNRSESTDSLGGLSPSEVTAIQCKNIPDYLNDRTILENHFGKIAKVQRIFTRRSKKLAVVHFFDHASAALARKKGKSLHKDMAIFWHRKKISPNKKPFSLKEKKPGDGEVSPSTEDAPFQHSPLGKAAGRTGASSLLNKSSPVKKPSLLKAHQFEGDSFDSASEGSEGLGPCVLSLSTLIGTVAETSKEKYRLLDQRDRIMRQARVKRTDLDKARTFVGTCLDMCPEKERYMRETRSQLSVFEVVPGTDQVDHAAAVKEYSRSSADQEEPLPHELRPLPVLSRTMDYLVTQIMDQKEGSLRDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASEAEFQGYNVLLSLNKGDILREVQQFHPAVRNSSEVKFAVQAFAALNSNNFVRFFKLVQSASYLNACLLHCYFSQIRKDALRALNFAYTVSTQRSTIFPLDGVVRMLLFRDCEEATDFLTCHGLTVSDGCVELNRSAFLEPEGLSKTRKSVFITRKLTVSVGEIVNGGPLPPVPRHTPVCSFNSQNKYIGESLAAELPVSTQRPGSDTVGGGRGEECGVEPDAPLSSLPQSLPAPAPSPVPLPPVLALTPSVAPSLFQLSVQPEPPPPEPVPMYSDEDLAQVVDELIQEALQRDCEEVGSAGAAYAAAALGVSNAAMEDLLTAATTGILRHIAAEEVSKERERREQERQRAEEERLKQERELVLSELSQGLAVELMERVMMEFVRETCSQELKNAVETDQRVRVARCCEDVCAHLVDLFLVEEIFQTAKETLQELQCFCKYLQRWREAVTARKKLRRQMRAFPAAPCCVDVSDRLRALAPSAECPIAEENLARGLLDLGHAGRLGISCTRLRRLRNKTAHQMKVQHFYQQLLSDVAWASLDLPSLVAEHLPGRQEHVFWKLVLVLPDVEEQSPESCGRILANWLKVKFMGDEGSVDDTSSDAGGIQTLSLFNSLSSKGDQMISVNVCIKVAHGALSDGAIDAVETQKDLLGASGLMLLLPPKMKSEDMAEEDVYWLSALLQLKQLLQAKPFQPALPLVVLVPSPGGDAVEKEVEDGLMLQDLVSAKLISDYTVTEIPDTINDLQGSTKVLQAVQWLVSHCPHSLDLCCQTLIQYVEDGIGHEFSGRFFHDRRERRLGGLASQEPGAIIELFNSVLQFLASVVSSEQLCDLSWPVTEFAEAGGSRLLPHLHWNAPEHLAWLKQAVLGFQLPQMDLPPLGAPWLPVCSMVVQYASQIPSSRQTQPVLQSQVENLLHRTYCRWKSKSPSPVHGAGPSVMEIPWDDLIALCINHKLRDWTPPRLPVTSEALSEDGQICVYFFKNDLKKYDVPLSWEQARLQTQKELQLREGRLAIKPFHPSANNFPIPLLHMHRNWKRSTECAQEGRIPSTEDLMRGASAEELLAQCLSSSLLLEKEENKRFEDQLQQWLSEDSGAFTDLTSLPLYLPQTLVSLSHTIEPVMKTSVTTSPQSDMMREQLQLSEATGTCLGERLKHLERLIRSSREEEVASELHLSALLDMVDI DIP protein O60318 original sequence version: 99 503D192686FC38A8 sac3_yeast Nuclear mRNA export protein SAC3 SAC3 LEP1 YDR159W YD8358.13 Leucine permease transcriptional regulator protein protein yeast Saccharomyces cerevisiae Baker's yeast MNTSFGSVVPSTNFNFFKGHGNNDNTSANSTVNNSNFFLNSNETKPSKNVFMVHSTSQKKSQQPLQNLSHSPSYTENKPDKKKKYMINDAKTIQLVGPLISSPDNLGFQKRSHKARELPRFLINQEPQLEKRAFVQDPWDKANQEKMISLEESIDDLNELYETLKKMRNTERSIMEEKGLVDKADSAKDLYDAIVFQGTCLDMCPTFERSRRNVEYTVYSYEKNQPNDKKASRTKALKVFARPAAAAAPPLPSDVRPPHILVKTLDYIVDNLLTTLPESEGFLWDRMRSIRQDFTYQNYSGPEAVDCNERIVRIHLLILHIMVKSNVEFSLQQELEQLHKSLITLSEIYDDVRSSGGTCPNEAEFRAYALLSKIRDPQYDENIQRLPKHIFQDKLVQMALCFRRVISNSAYTERGFVKTENCLNFYARFFQLMQSPSLPLLMGFFLQMHLTDIRFYALRALSHTLNKKHKPIPFIYLENMLLFNNRQEIIEFCNYYSIEIINGDAADLKTLQHYSHKLSETQPLKKTYLTCLERRLQKTTYKGLINGGEDNLASSVYVKDPKKDRIPSIADQSFLMENFQNNYNEKLNQNSSVKPQINTSPKRVATRPNHFPFSQESKQLPQISQSHTLSTNPLLTPQVHGDLSEQKQQQIKTVTDGGSPFVFDQSAQNSTVEASKAHMISTTSNGAYDEKLSSEQEEMRKKEEQRIEEEKTQLKKKQENADKQVITEQIANDLVKEVVNSSVISIVKREFSEANYRKDFIDTMTRELYDAFLHERLYLIYMDSRAELKRNSTLKKKFFEKWQASYSQAKKNRILEEKKREEIKLVSHQLGVPGFKKSTCLFRTPYKGNVNSSFMLSSSDKNLIFSPVNDEFNKFATHLTKISKLWRPLEMQSIYYDNLTKKFPSNSLTPANLFIYAKDWTSLSNRWILSKFNLQTAQDSKKFSNNIISSRIICIDDEYEPSDFSDLQLLIFNTGVTNPDIFDLEMKLKDDGEELIKLITGISLNTNICFSLLIIYWESAENTLSESTIKHLLKLNRISKNYSSVIERIDLMNLTEESPHKCLEDKLSEISHSYVYKLTERGKYDKTLRQKRSLAGIHSRSTQLQTTKDIDQKMKKMLEKEKNKYQQQIGERNTYAHLESHIDASPRSKKRKLPILLSTSHSSQFKTPLASRLNTSGSSTSPPLPSHLAMKFRKNSRVTSLHTVLPVSTPSHSNNIPAASFSGNNTTDIQSQQLIENQKSTSVYLNNVSERILGNQEICQTPINPVTPVLDGADQGKEDIPDSILELKILIDSVKKKVNND 0679DB1673DDACEB 0679DB1673DDACEB sus1_yeast Transcription and mRNA export factor SUS1 SUS1 YBR111W-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MTMDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ DB0DA0C9DC13FB21 DB0DA0C9DC13FB21 cdc31_yeast Cell division control protein 31 YOR257W CDC31 DSK1 Nucleoporin CDC31 Nuclear pore protein CDC31 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKNRSSLQSGPLNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS 25A546E76E1EF520 25A546E76E1EF520 q5jvf3-1 PCI domain-containing protein 2 CSN12-like protein HT004 PCID2 protein protein human Homo sapiens Human MAHITINQYLQQVYEAIDSRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFANNADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC DIP protein Q5JVF3-1 original sequence version: 70 sem1_yeast 26S proteasome complex subunit SEM1 SEM1 DSH1 YDR363W-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTDVAAAQAQSKIDLTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIKSNAVTQTNIWEENWDDVEVDDDFTNELKAELDRYKRENQ B66B578ABB01E672 B66B578ABB01E672 thp1_yeast Nuclear mRNA export protein THP1 Bud site selection protein 29 THP1 BUD29 O1140 YOL072W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDMANQLLDELAHGNFSHLTLNLSQNGREIAILQKQLTGFDDKQLETFVEQHPAMPNDTRFKIMCTSFLNYARDVDPWSAWSSSDLIFEFYQCLINCLINDNAPHIEMLIPVATRETEFIINLAGKLDSFHLQLHTRSHQFLSHISSILSRLFNSIKPPRGNASSTNIPGKQRILLYLVNKLNNIYFRIESPQLCSNIFKNFQPKSMLAHFNEYQLDQQIEYRYLLGRYYLLNSQVHNAFVQFNEAFQSLLNLPLTNQAITRNGTRILNYMIPTGLILGKMVKWGPLRPFLSQETIDNWSVLYKHVRYGNIQGVSLWLRQNERHLCARQLLIVLLEKLPMVTYRNLIKTVIKSWTTEWGQNKLPYSLIERVLQLSIGPTFEDPGAQEITIYNGIHSPKNVENVLVTLINLGLLRANCFPQLQLCVVKKTTMIQEIVPPVNERITKMFPAHSHVLW 7026F1F6FCC73FFA 7026F1F6FCC73FFA sac3-sem1-1 4 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 250-563 Region 250-563 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association sem1-sac3-1 5 18 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role prey prey Region 250-563 Region 250-563 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association pcid2-sem1-7 7 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role Region 201-399 Region 201-399 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction sac3-sem1-2 10 18 unspecified role unspecified role prey prey ecolx Escherichia coli 19 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 14 unspecified role unspecified role bait bait Region 250-563 Region 250-563 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P46674:p.[Phe391Ala;Phe425Asp] F391A/F425D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F D certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F391A/F425D'. Wed May 02 18:54:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe391ala,phe425asp' Tue Jun 30 17:02:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe391Ala;Phe425Asp]' ecolx Escherichia coli association association pcid2-sem1-8 9 12 unspecified role unspecified role prey prey ecolx Escherichia coli 17 unspecified role unspecified role bait bait Region 201-399 Region 201-399 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association sac3-sem1-3 8 18 unspecified role unspecified role prey prey ecolx Escherichia coli 19 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q08231:p.[Val405Tyr;Thr406Trp] V405Y/T406W mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T W certain certain sequence position certain certain certain sequence position certain V Y This feature has been corrected as a result of our quality control procedures. The original label was 'V405Y/T406W'. Wed May 02 17:56:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val405tyr,thr406trp' Tue Jun 30 19:19:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val405Tyr;Thr406Trp]' ecolx Escherichia coli 14 unspecified role unspecified role bait bait Region 250-563 Region 250-563 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association sac3-sem1-4 1 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 250-563 Region 250-563 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association pcid2-sem1-9 2 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role Region 201-399 Region 201-399 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction thp1-cdc31-1 6 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association mcm3ap-pcid2-1 3 13 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 686-981 Region 686-981 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role prey prey ecolx Escherichia coli 17 unspecified role unspecified role prey prey Region 201-399 Region 201-399 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association thp1-sem1-1 11 18 unspecified role unspecified role prey prey ecolx Escherichia coli 19 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association