DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. Structure (London, England : 1993) 2012 imex curation Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. DIP original experiment: DIP-249272X Structure (London, England : 1993) 2012 IMEx The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. Structure (London, England : 1993) 2012 imex curation Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. DIP original experiment: DIP-249269X Structure (London, England : 1993) 2012 IMEx The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. Structure (London, England : 1993) 2012 imex curation Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. Only protein-protein interactions in vitro In vitro protein phosphatase assay protein phosphatase assay predetermined predetermined participant predetermined Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. DIP original experiment: DIP-249273X Structure (London, England : 1993) 2012 IMEx The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. Structure (London, England : 1993) 2012 imex curation Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. DIP original experiment: DIP-249270X Structure (London, England : 1993) 2012 IMEx The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. Structure (London, England : 1993) 2012 imex curation Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. DIP original experiment: DIP-249277X Structure (London, England : 1993) 2012 IMEx The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. Structure (London, England : 1993) 2012 imex curation Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. DIP original experiment: DIP-249275X Structure (London, England : 1993) 2012 IMEx The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. Structure (London, England : 1993) 2012 imex curation Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. DIP original experiment: DIP-249274X Structure (London, England : 1993) 2012 IMEx The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. Structure (London, England : 1993) 2012 imex curation Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. DIP original experiment: DIP-249271X Structure (London, England : 1993) 2012 IMEx The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. Structure (London, England : 1993) 2012 imex curation Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Quin MB., Berrisford JM., Newman JA., Baslé A., Lewis RJ., Marles-Wright J. DIP original experiment: DIP-249276X Structure (London, England : 1993) 2012 IMEx The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling. q2rif6_moota Moth_1473 protein protein moota Moorella thermoacetica (strain ATCC 39073 / JCM 9320) MNLKQTLPITSEYDIITARQAAREIARQIGFNTVDQVRIATAVSELTRNVVLYAGFGKVDIEVVTRGERQGIEITVSDQGPGIADIELALRDGYSSSNGLGAGLSGARRLMDTFFIESRVGQGTTVRIGKWKNWK DIP protein Q2RIF6 original sequence version: 35 q2rif4_moota Moth_1475 protein protein moota Moorella thermoacetica (strain ATCC 39073 / JCM 9320) MDICGELKAENIVEKAINLLSKEDQAGVHFNEISALTRDFCRAILSDLEQSGFTTSELEKEIADKVKIMFAQGYHIEVLQLILEKILDSFISVIREQYHDLQAAASYITTVRDHIFKGTSFLLKMALQTQREVIQKQNEALMELSTPVIPLMQDILLLPLIGTIDTRRAKEIMDNLLEGIVRYQAEVVIIDISGVPVVDTQVAHHLIKTVKAARLLGSRCILVGIRPELAQTIVRLGIDFPDIITKNNLHAGLELAFRWLGYRLERVEHDHE DIP protein Q2RIF4 original sequence version: 34 q2rif7_moota Moth_1472 protein protein moota Moorella thermoacetica (strain ATCC 39073 / JCM 9320) MEKLEVGIYTRAREGEIACGDACLVKRVEGVIFLAVGDGIGHGPEAARAAEIAIASMESSMNTGLVNIFQLCHRELRGTRGAVAALCRVDRRQGLWQAAIVGNIHVKILSAKGIITPLATPGILGYNYPHQLLIAKGSYQEGDLFLIHSDGIQEGAVPLALLANYRLTAEELVRLIGEKYGRRDDDVAVIVAR DIP protein Q2RIF7 original sequence version: 38 q2rif8_moota Moth_1471 protein protein moota Moorella thermoacetica (strain ATCC 39073 / JCM 9320) MEIQWQETYFKLLHQYSLQQSEAILYEASKLSKALVEKGVGPEDIVQFHLEALEKLFKDISPLRVPGLILISFDLLLEVMMAYALNFREYLEVKNKLIERLENFNQELAAANRALEMKVKELSVIQELTKELGSCLDLDRTAGIITRHLQELLNCEVNLYIISSNGEWQGYTPDDDPEAVSISKNIDVPPPVLEARGGEAVRVEGRDLTLPLVVDREVGGAIYLQRDDSFSADEFRLADIIAGYAALAIERARLYEAMKFQATIDAKTGLYNYQHMMHLLEKEIARARRYQRTFTIAMLDIDDFKIYNDTHGHHQGDKALQKIAALIKANIREVDIAARYGGEEFVIIMPETSALEASVVAERVRRAIMNAGIANVGCGPDRLLTVSIGLGTYPHDATTAGKLIDAADSALYEAKRWGKNVVRVYSKTDRRRSGDAEVL DIP protein Q2RIF8 original sequence version: 36 q2rif5_moota Moth_1474 protein protein moota Moorella thermoacetica (strain ATCC 39073 / JCM 9320) MSSRVPILKVDDYWVVAIEETLHDQSVIQFKEELLHNITGVAGKGLVIDISALEVVDSFVTRVLIEISRLAELLGLPFVLTGIKPAVAITLTEMGLDLRGMATALNLQKGLDKLKNLARMEQR DIP protein Q2RIF5 original sequence version: 35 q2rif4_moota-1 2 11 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-146 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q2rif5_moota-q2rif6_moota-1 1 10 unspecified role unspecified role prey prey ecolx Escherichia coli 14 unspecified role unspecified role bait bait Q2RIF5:p.Ser58Glu S58E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S E This feature has been corrected as a result of our quality control procedures. The original label was 'S58E'. Wed May 02 15:50:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser58glu' Tue Jun 30 17:55:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser58Glu' ecolx Escherichia coli direct interaction direct interaction q2rif8_moota-q2rif6_moota-1 7 10 unspecified role unspecified role prey prey ecolx Escherichia coli 13 unspecified role unspecified role bait bait Region 1-109 Region 1-109 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction q2rif6_moota-q2rif8_moota-1 9 10 unspecified role unspecified role bait bait ecolx Escherichia coli 13 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction q2rif6_moota-q2rif8_moota-2 5 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 1-109 Region 1-109 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q2rif4_moota-q2rif5_moota-1 4 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction q2rif5_moota-q2rif7_moota-1 3 12 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 14 enzyme target enzyme target substrate substrate unspecified role unspecified role pS58 pS58 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli dephosphorylation dephosphorylation reaction dephosphorylation q2rif6_moota-q2rif8_moota-3 6 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 1-87 Region 1-87 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q2rif5_moota-q2rif6_moota-2 8 10 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 14 enzyme target enzyme target substrate substrate unspecified role unspecified role pS58 pS58 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation