DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. DIP original experiment: DIP-251530X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. DIP original experiment: DIP-251529X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. DIP original experiment: DIP-251537X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. DIP original experiment: DIP-251526X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. DIP original experiment: DIP-251536X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. DIP original experiment: DIP-251532X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. DIP original experiment: DIP-251535X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. DIP original experiment: DIP-251533X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. DIP original experiment: DIP-251527X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. DIP original experiment: DIP-251531X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. DIP original experiment: DIP-251528X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Wu MF., Sang Y., Bezhani S., Yamaguchi N., Han SK., Li Z., Su Y., Slewinski TL., Wagner D. DIP original experiment: DIP-251534X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx SWI2/SNF2 chromatin remodeling ATPases overcome polycomb repression and control floral organ identity with the LEAFY and SEPALLATA3 transcription factors. swi3c_arath SWI/SNF complex subunit SWI3C SWI3C At1g21700 CHB4 Transcription regulatory protein SWI3C F8K7.13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPASEDRRGKWKRKKRGGLSAARKPKQEEEDMEEEDEENNNNNNEEMDDVENADELQQNGGATPDPGLGIGEVVEDSGSRISDFPAVVKRVVIRPHASVMAVVAAERAGLIGETRGQGSLPALENISFGQLQALSTVPADSLDLERSDGSSSAYVISPPPIMDGEGVVKRFGDLVHVLPMHSDWFAPNTVDRLERQVVPQFFSGKSPNHTPESYMEFRNAIVSKYVENPEKTLTISDCQGLVDGVDIEDFARVFRFLDHWGIINYCATAQSHPGPLRDVSDVREDTNGEVNVPSAALTSIDSLIKFDKPNCRHKGGEVYSSLPSLDGDSPDLDIRIREHLCDSHCNHCSRPLPTVYFQSQKKGDILLCCDCFHHGRFVVGHSCLDFVRVDPMKFYGDQDGDNWTDQETLLLLEAVELYNENWVQIADHVGSKSKAQCILHFLRLPVEDGLLDNVEVSGVTNTENPTNGYDHKGTDSNGDLPGYSEQGSDTEIKLPFVKSPNPVMALVAFLASAVGPRVAASCAHESLSVLSEDDRMKSEGMQGKEASLLDGENQQQDGAHKTSSQNGAEAQTPLPQDKVMAAFRAGLSAAATKAKLFADHEEREIQRLSANIVNHQLKRMELKLKQFAEIETLLMKECEQVEKTRQRFSAERARMLSARFGSPGGISPQTNNLQGMSLSTGGNNINSLMHQQHQQQQASATSQPSIIPGFSNNPQVQAQMHFMARQQQQQQQQQQQQQQAFSFGPRLPLNAIQTNAGSTASPNVMFGNNQLNNPAAAGAASINQPSFSHPMVRSSTGSGSGSGLGLN DIP protein Q9XI07 original sequence version: 101 DAB17C104E4B287F sep3_arath Developmental protein SEPALLATA 3 Agamous-like MADS-box protein AGL9 SEP3 AGL9 At1g24260 F3I6.19 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRLADGYQMPLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQDGMGAGPSVNNYMLGWLPYDTNSI DIP protein O22456 original sequence version: 117 DIP protein O22456 original sequence version: 110 0057CABD3F1AFC40 lfy_arath Protein LEAFY LFY MAC9.18 At5g61850 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPEGFTSGLFRWNPTRALVQAPPPVPPPLQQQPVTPQTAAFGMRLGGLEGLFGPYGIRFYTAAKIAELGFTASTLVGMKDEELEEMMNSLSHIFRWELLVGERYGIKAAVRAERRRLQEEEEEESSRRRHLLLSAAGDSGTHHALDALSQEGLSEEPVQQQDQTDAAGNNGGGGSGYWDAGQGKMKKQQQQRRRKKPMLTSVETDEDVNEGEDDDGMDNGNGGSGLGTERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLLQVQTIAKDRGEKCPTKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGSWRQACYKPLVNIACRHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLERNNAVAAAAALVGGISCTGSSTSGRGGCGGDDLRF DIP protein Q00958 original sequence version: 99 952268D52E035CFF brm_arath ATP-dependent helicase BRM CHR2 Protein CHROMATIN REMODELING 2 F4I18 T3F17.33 At2g46020 BRM Protein BRAHMA protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQSGGSGGGPARNPAMGPAGRTASTSSAASPSSSSSSVQQQQQQQQQQQQQQQLASRQQQQQHRNSDTNENMFAYQPGGVQGMMGGGNFASSPGSMQMPQQSRNFFESPQQQQQQQQQGSSTQEGQQNFNPMQQAYIQFAMQAQHQKAQQQARMGMVGSSSVGKDQDARMGMLNMQDLNPSSQPQASSSKPSGDQFARGERQTESSSQQRNETKSHPQQQVGTGQLMPGNMIRPMQAPQAQQLVNNMGNNQLAFAQQWQAMQAWARERNIDLSHPANASQMAHILQARMAAQQKAGEGNVASQSPSIPISSQPASSSVVPGENSPHANSASDISGQSGSAKARHALSTGSFASTSSPRMVNPAMNPFSGQGRENPMYPRHLVQPTNGMPSGNPLQTSANETPVLDQNASTKKSLGPAEHLQMQQPRQLNTPTPNLVAPSDTGPLSNSSLQSGQGTQQAQQRSGFTKQQLHVLKAQILAFRRLKKGEGSLPPELLQAISPPPLELQTQRQISPAIGKVQDRSSDKTGEDQARSLECGKESQAAASSNGPIFSKEEDNVGDTEVALTTGHSQLFQNLGKEATSTDVATKEEQQTDVFPVKSDQGADSSTQKNPRSDSTADKGKAVASDGSQSKVPPQANSPQPPKDTASARKYYGPLFDFPFFTRKLDSYGSATANANNNLTLAYDIKDLICEEGAEFLSKKRTDSLKKINGLLAKNLERKRIRPDLVLRLQIEEKKLRLSDLQSRVREEVDRQQQEIMSMPDRPYRKFVRLCERQRLEMNRQVLANQKAVREKQLKTIFQWRKKLLEAHWAIRDARTARNRGVAKYHEKMLREFSKRKDDGRNKRMEALKNNDVERYREMLLEQQTNMPGDAAERYAVLSSFLTQTEDYLHKLGGKITATKNQQEVEEAANAAAVAARLQGLSEEEVRAAATCAREEVVIRNRFTEMNAPKENSSVNKYYTLAHAVNEVVVRQPSMLQAGTLRDYQLVGLQWMLSLYNNKLNGILADEMGLGKTVQVMALIAYLMEFKGNYGPHLIIVPNAVLVNWKSELHTWLPSVSCIYYVGTKDQRSKLFSQEVCAMKFNVLVTTYEFIMYDRSKLSKVDWKYIIIDEAQRMKDRESVLARDLDRYRCQRRLLLTGTPLQNDLKELWSLLNLLLPDVFDNRKAFHDWFAQPFQKEGPAHNIEDDWLETEKKVIVIHRLHQILEPFMLRRRVEDVEGSLPAKVSVVLRCRMSAIQSAVYDWIKATGTLRVDPDDEKLRAQKNPIYQAKIYRTLNNRCMELRKACNHPLLNYPYFNDFSKDFLVRSCGKLWILDRILIKLQRTGHRVLLFSTMTKLLDILEEYLQWRRLVYRRIDGTTSLEDRESAIVDFNDPDTDCFIFLLSIRAAGRGLNLQTADTVVIYDPDPNPKNEEQAVARAHRIGQTREVKVIYMEAVVEKLSSHQKEDELRSGGSVDLEDDMAGKDRYIGSIEGLIRNNIQQYKIDMADEVINAGRFDQRTTHEERRMTLETLLHDEERYQETVHDVPSLHEVNRMIARSEEEVELFDQMDEEFDWTEEMTNHEQVPKWLRASTREVNATVADLSKKPSKNMLSSSNLIVQPGGPGGERKRGRPKSKKINYKEIEDDIAGYSEESSEERNIDSGNEEEGDIRQFDDDELTGALGDHQTNKGEFDGENPVCGYDYPPGSGSYKKNPPRDDAGSSGSSPESHRSKEMASPVSSQKFGSLSALDTRPGSVSKRLLDDLEEGEIAASGDSHIDLQRSGSWAHDRDEGDEEQVLQPTIKRKRSIRLRPRQTAERVDGSEMPAAQPLQVDRSYRSKLRTVVDSHSSRQDQSDSSSRLRSVPAKKVASTSKLHVSSPKSGRLNATQLTVEDNAEASRETWDGTSPISSSNAGARMSHIIQKRCKIVISKLQRRIDKEGQQIVPMLTNLWKRIQNGYAAGGVNNLLELREIDHRVERLEYAGVMELASDVQLMLRGAMQFYGFSHEVRSEAKKVHNLFFDLLKMSFPDTDFREARNALSFSGSAPTLVSTPTPRGAGISQGKRQKLVNEPETEPSSPQRSQQRENSRIRVQIPQKETKLGGTTSHTDESPILAHPGELVICKKKRKDREKSGPKTRTGGSSSPVSPPPAMIGRGLRSPVSGGVPRETRLAQQQRWPNQPTHPNNSGAAGDSVGWANPVKRLRTDSGKRRPSHL DIP protein Q6EVK6 original sequence version: 75 ECC557B079A91301 syd_arath Chromatin structure-remodeling complex protein SYD SYD CHR3 ATP-dependent helicase SYD Protein CHROMATIN REMODELING 3 Protein SPLAYED T3B23 At2g28290 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTSSSHNIELEAAKFLHKLIQDSKDEPAKLATKLYVILQHMKTSGKENTMPYQVISRAMDTVVNQHGLDIEALKSSCLPHPGGTQTEDSGSAHLAGSSQAVGVSNEGKATLVENEMTKYDAFTSGRQLGGSNSASQTFYQGSGTQSNRSFDRESPSNLDSTSGISQPHNRSETMNQRDVKSSGKRKRGESSLSWDQNMDNSQIFDSHKIDDQTGEVSKIEMPGNSGDIRNLHVGLSSDAFTTPQCGWQSSEATAIRPAIHKEPGNNVAGEGFLPSGSPFREQQLKQLRAQCLVFLALRNGLVPKKLHVEIALRNTFREEDGFRGELFDPKGRTHTSSDLGGIPDVSALLSRTDNPTGRLDEMDFSSKETERSRLGEKSFANTVFSDGQKLLASRIPSSQAQTQVAVSHSQLTFSPGLTKNTPSEMVGWTGVIKTNDLSTSAVQLDEFHSSDEEEGNLQPSPKYTMSQKWIMGRQNKRLLVDRSWSLKQQKADQAIGSRFNELKESVSLSDDISAKTKSVIELKKLQLLNLQRRLRSEFVYNFFKPIATDVEHLKSYKKHKHGRRIKQLEKYEQKMKEERQRRIRERQKEFFGGLEVHKEKLEDLFKVRRERLKGFNRYAKEFHKRKERLHREKIDKIQREKINLLKINDVEGYLRMVQDAKSDRVKQLLKETEKYLQKLGSKLKEAKLLTSRFENEADETRTSNATDDETLIENEDESDQAKHYLESNEKYYLMAHSIKENINEQPSSLVGGKLREYQMNGLRWLVSLYNNHLNGILADEMGLGKTVQVISLICYLMETKNDRGPFLVVVPSSVLPGWQSEINFWAPSIHKIVYCGTPDERRKLFKEQIVHQKFNVLLTTYEYLMNKHDRPKLSKIHWHYIIIDEGHRIKNASCKLNADLKHYVSSHRLLLTGTPLQNNLEELWALLNFLLPNIFNSSEDFSQWFNKPFQSNGESSAEEALLSEEENLLIINRLHQVLRPFVLRRLKHKVENELPEKIERLIRCEASAYQKLLMKRVEDNLGSIGNAKSRAVHNSVMELRNICNHPYLSQLHSEEVNNIIPKHFLPPIVRLCGKLEMLDRMLPKLKATDHRVLFFSTMTRLLDVMEDYLTLKGYKYLRLDGQTSGGDRGALIDGFNKSGSPFFIFLLSIRAGGVGVNLQAADTVILFDTDWNPQVDLQAQARAHRIGQKKDVLVLRFETVNSVEEQVRASAEHKLGVANQSITAGFFDNNTSAEDRKEYLESLLRESKKEEDAPVLDDDALNDLIARRESEIDIFESIDKQRKENEMETWNTLVHGPGSDSFAHIPSIPSRLVTEDDLKLLYETMKLNDVPMVAKESTVGMKRKDGSMGGLDTHQYGRGKRAREVRSYEEKLTEEEFEKLCQTESPDSPQGKGEGSERSLANDTSNIPVENSSDTLLPTSPTQAITVQPMEPVRPQSHTLKEETQPIKRGRGRPKRTDKALTPVSLSAVSRTQATGNAISSAATGLDFVSSDKRLEAASHPTSSLALTSPDLSGPPGFQSLPASPAPTPIRGRGRGRSRGRGAGRGRRVEGVLHGSNSSITQRTETATSLASDAEATKFALPRSASEIVSRVPKANEGSTSNPDQVSPVHSATTALRSDKAADKDLDAPPGFDSGSHVQTLNVLENSSERKAFAVKKRPLIQGVSSQHPGPNKQPLDLPVSTSSTLLGGGPVQNQNAVSSVCDGSKSPSEGRTYTALQGVTTAPSDATLPMSSQPSDATLPMSSQPVGSTVEAQEANVPSLPAALPAKRRVRNLPSRGETPKRQGKRRGQPLPATDASSARSTGLTPQIEVKVGNLSGTKAKFDAVAKEQPHFSQSVAPDIHSSGSLSQEIRRDTSGTGGSARKQTADVTDVARVMKEIFSETSLLKHKVGEPSATTRTNVPDAQSPGEMNLHTVETHKAEDSSGLKNQEALYNLSKADKLVSDIPHPVPGDLTTSGSVANKDVDIGSSKVAAENELVKIPGGDVDSSVIQLSLGNTLTAKSSLEKCTADQLLGEKLSQEGETTPASDGETCHLAEETASSLSYVRSEPTASASTTAEPLPTDKLEKNISFQDEVKTLNGDKREAILLSSEEQTNVNSKIETNSEELQASRTDEVPHVDGKSVDVANQTVKEDEAKHSVEIQSSMLEPDELPNAGQKGHSSIDLQPLVLVTSNENAMSLDDKDYDPISKSADIEQDPEESVFVQGVGRPKVGTADTQMEDTNDAKLLVGCSVESEEKEKTLQSLIPGDDADTEQDPEESVSDQRPKVGSAYTQMEDTDEAKLLMGCSVESEEKEKTLQSHIPGDDADTEKNPEESVSVQGVDRPKVGTTDTQMEDTNDAKLLVGCSVASEEKEKTLQSHIPGDDADTEQNPEESVSVQGVNRPKVGNANTQMEDTDEAKVLVGCSVESEEKEKTLQSHIPGDDADTEQNPEESVSNFDRPKDGTADTHMEDIDDAKLLVGCSVESEEKEKSLQSHMPSDDAVLHAPFENTKDSKGDDLHGESLVSCPTMEVMEQKGFESETHARTDSGGIDRGNEVSENMSDGVKMNISSVQVPDASHDLNVSQDQTDIPLVGGIDPEHVQENVDVPASPHGAAPNIVIFQSEGHLSPSILPDDVAGQLESMSNDEKTNISSEQVPDVSHDLKVSQDQTDIPPVGGIVPENLQEIVDVPASPHGVVPDVVVSQSEEIQSPSILPDDVPGQPDDGNCEKMDTMQNNTSIDIGITSGKTCQPSSSTQPEDENRNSLSHCEPSEVVEQRDSRDQVCIGSVESQVEISSAILENRSADIQPPQSILVDQKDIEESKEPGIESADVSLHQLADIQAEPSNLVDQMDIEESKEPGTESADVSLHQLADIQPGPSILVDQMDTEKSKEPGTESADVSLHQLADIQPGPSILVDQMDTEKSKEPGTESADVSLHQLADIQPGPSILVDQMDTEEFKNPDVSLHQLADIEPSLSISAVQKNIEDKDQSHVETAGSELVDVSAECSTEPQVQLPPSSEPVGDMHVHLGASKSEIVAEGTDFSSSLPKTEEENAKSQLADTEPSSSLTAVQKNIEDQVETAGCEFVVVSTGCSTEPQVQLPPSAEPVVAEGTEFPSSLLMTGVDNSSHLMTGVDNAKTHLADVVPSSSPTTMEKNIEAQDQDQVTTGGCGLVDVLTECSSEPQLQLPPSAEPVISEGTELATLPLTEEENADSQLANIEPSSSPSVVEKNIEAQDQDQVKTAGCELVSTGCSSEPQVHLPPSAEPDGDIHVHLKETEKSESMVVVGEGTAFPSSLPVTEEGNAESQLADTEPFTSPTVVEKNIKDQEQVETTGCGLVDDSTGCSSEPQVQLPPSAEPMEGTHMHLEETKKSETVVTEIQLADIDPSFSLIVVQTNIEDQDQIETGGCDLINVPSGCSTEPQIQLSSSAEPEEGMHIHLEAAMNSETVVTEGSELPSSLPMTEDENADGQLAEVEPSVSLTVEQTNIEEKDHIETAECELVDVSPGCSSQPEVKFPPSPDAVGGMDVHLETVVTEDTDSNSSLPKTEEKDAENPSDRLDGESDGTTVATVEGTCVESNSLVAEESNIEVPKDNEDV DIP protein F4IHS2 original sequence version: 16 lfy-syd-1 4 17 unspecified role unspecified role prey prey Region 221-551 Region 221-551 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 573-726 Region 573-726 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 15 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction syd-lfy-1 10 17 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 15 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association lfy-syd-2 11 17 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-657 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 15 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association sep3-syd-1 6 14 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey N-terminal domain Region 1-657 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction sep3-brm-1 8 14 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 16 unspecified role unspecified role prey prey N-terminal domain Region 1-976 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction brm-lfy-1 3 16 unspecified role unspecified role bait bait N-terminal domain Region 1-976 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association brm-swi3c-3 1 13 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 16 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-976 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association brm-sep3-1 7 14 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 16 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-976 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association lfy-brm-1 9 16 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 422-773 Region 422-773 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 631-885 Region 631-885 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 15 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction sep3-syd-2 12 14 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 17 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-657 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association syd-lfy-2 5 17 unspecified role unspecified role bait bait N-terminal domain Region 1-657 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association brm-lfy-2 2 16 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-976 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 15 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association