DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Nature 2012 imex curation Kim TW., Michniewicz M., Bergmann DC., Wang ZY. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kim TW., Michniewicz M., Bergmann DC., Wang ZY. DIP original experiment: DIP-249401X Nature 2012 IMEx Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Nature 2012 imex curation Kim TW., Michniewicz M., Bergmann DC., Wang ZY. Only protein-protein interactions nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kim TW., Michniewicz M., Bergmann DC., Wang ZY. DIP original experiment: DIP-249397X Nature 2012 IMEx Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Nature 2012 imex curation Kim TW., Michniewicz M., Bergmann DC., Wang ZY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim TW., Michniewicz M., Bergmann DC., Wang ZY. DIP original experiment: DIP-249398X Nature 2012 IMEx Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Nature 2012 imex curation Kim TW., Michniewicz M., Bergmann DC., Wang ZY. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kim TW., Michniewicz M., Bergmann DC., Wang ZY. DIP original experiment: DIP-249402X Nature 2012 IMEx Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Nature 2012 imex curation Kim TW., Michniewicz M., Bergmann DC., Wang ZY. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Kim TW., Michniewicz M., Bergmann DC., Wang ZY. DIP original experiment: DIP-249400X Nature 2012 IMEx Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. Nature 2012 imex curation Kim TW., Michniewicz M., Bergmann DC., Wang ZY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim TW., Michniewicz M., Bergmann DC., Wang ZY. DIP original experiment: DIP-249399X Nature 2012 IMEx Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway. yoda_arath Mitogen-activated protein kinase kinase kinase YODA YDA YODA MAPKK kinase F24D7.11 At1g63700 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPWWSKSKDEKKKTNKESIIDAFNRKLGFASEDRSSGRSRKSRRRRDEIVSERGAISRLPSRSPSPSTRVSRCQSFAERSPAVPLPRPIVRPHVTSTDSGMNGSQRPGLDANLKPSWLPLPKPHGATSIPDNTGAEPDFATASVSSGSSVGDIPSDSLLSPLASDCENGNRTPVNISSRDQSMHSNKNSAEMFKPVPNKNRILSASPRRRPLGTHVKNLQIPQRDLVLCSAPDSLLSSPSRSPMRSFIPDQVSNHGLLISKPYSDVSLLGSGQCSSPGSGYNSGNNSIGGDMATQLFWPQSRCSPECSPVPSPRMTSPGPSSRIQSGAVTPLHPRAGGSTTGSPTRRLDDNRQQSHRLPLPPLLISNTCPFSPTYSAATSPSVPRSPARAEATVSPGSRWKKGRLLGMGSFGHVYLGFNSESGEMCAMKEVTLCSDDPKSRESAQQLGQEISVLSRLRHQNIVQYYGSETVDDKLYIYLEYVSGGSIYKLLQEYGQFGENAIRNYTQQILSGLAYLHAKNTVHRDIKGANILVDPHGRVKVADFGMAKHITAQSGPLSFKGSPYWMAPEVIKNSNGSNLAVDIWSLGCTVLEMATTKPPWSQYEGVPAMFKIGNSKELPDIPDHLSEEGKDFVRKCLQRNPANRPTAAQLLDHAFVRNVMPMERPIVSGEPAEAMNVASSTMRSLDIGHARSLPCLDSEDATNYQQKGLKHGSGFSISQSPRNMSCPISPVGSPIFHSHSPHISGRRSPSPISSPHALSGSSTPLTGCGGAIPFHHQRQTTVNFLHEGIGSSRSPGSGGNFYTNSFFQEPSRQQDRSRSSPRTPPHVFWDNNGSIQPGYNWNKDNQPVLSDHVSQQLLSEHLKLKSLDLRPGFSTPGSTNRGP DIP protein Q9CAD5 original sequence version: 89 ksg7_arath Shaggy-related protein kinase eta ASK7 BIN2 DWF12 UCU1 ASK-eta Protein BRASSINOSTEROID INSENSITIVE 2 Protein ULTRACURVATA 1 F28A21.120 At4g18710 SK21 Shaggy-related protein kinase 21 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVPESLYRVLKHYSSANQRMPLVYVKLYMYQIFRGLAYIHNVAGVCHRDLKPQNLLVDPLTHQVKICDFGSAKQLVKGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPLFNFKQEVAGSSPELVNKLIPDHIKRQLGLSFLNQSGT DIP protein Q39011 original sequence version: 100 DIP protein Q39011 original sequence version: 121 DIP protein Q39011 original sequence version: 146 DIP protein Q39011 original sequence version: 129 DIP protein Q39011 original sequence version: 113 86C2FD5F77201168 bzr1_arath Protein BRASSINAZOLE-RESISTANT 1 BZR1 BIS2 Protein BIN2 SUBSTRATE 2 F9E10_7 At1g75080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTSDGATSTSAAAAAAAAAAARRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGDYNLPKHCDNNEVLKALCVEAGWVVEEDGTTYRKGCKPLPGEIAGTSSRVTPYSSQNQSPLSSAFQSPIPSYQVSPSSSSFPSPSRGEPNNNMSSTFFPFLRNGGIPSSLPSLRISNSCPVTPPVSSPTSKNPKPLPNWESIAKQSMAIAKQSMASFNYPFYAVSAPASPTHRHQFHTPATIPECDESDSSTVDSGHWISFQKFAQQQPFSASMVPTSPTFNLVKPAPQQMSPNTAAFQEIGQSSEFKFENSQVKPWEGERIHDVGMEDLELTLGNGKARG DIP protein Q8S307 original sequence version: 89 DIP protein Q8S307 original sequence version: 60 2CE6D6647D72C012 ask7-yda-1 2 7 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 8 unspecified role unspecified role bait bait YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana physical association physical association bzr1-ask7-2 6 9 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ask7-yda-2 4 8 enzyme enzyme unspecified role unspecified role Q39011:p.Met115Ala M115A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M115A'. Wed May 02 18:25:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met115ala' Tue Jun 30 18:43:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met115Ala' ecolx Escherichia coli 7 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 185-322 Region 185-322 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation yda-ask7-1 5 8 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction yda-ask7-2 3 7 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction Deletion of region 185-322 decreased the interaction rate/strength. ask7-5 1 8 putative self putative self unspecified role unspecified role Q39011:p.Met115Ala M115A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M115A'. Wed May 02 14:47:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met115ala' Tue Jun 30 16:59:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met115Ala' ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation true