DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Nature 2012 imex curation Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. Only protein-protein interactions in vitro In vitro ampylation assay ampylation assay ampylation assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. DIP original experiment: DIP-252136X Nature 2012 IMEx Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Nature 2012 imex curation Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. Only protein-protein interactions in vitro In vitro ampylation assay ampylation assay ampylation assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. DIP original experiment: DIP-252135X Nature 2012 IMEx Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Nature 2012 imex curation Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. Only protein-protein interactions in vitro In vitro ampylation assay ampylation assay ampylation assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. DIP original experiment: DIP-252137X Nature 2012 IMEx Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Nature 2012 imex curation Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. DIP original experiment: DIP-252134X Nature 2012 IMEx Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Nature 2012 imex curation Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. DIP original experiment: DIP-252133X Nature 2012 IMEx Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Nature 2012 imex curation Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. Only protein-protein interactions in vitro In vitro ampylation assay ampylation assay ampylation assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. DIP original experiment: DIP-252139X Nature 2012 IMEx Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Nature 2012 imex curation Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. Only protein-protein interactions in vitro In vitro ampylation assay ampylation assay ampylation assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. DIP original experiment: DIP-252138X Nature 2012 IMEx Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. ficd_human Protein adenylyltransferase FICD FICD HIP13 HYPE AMPylator FICD FIC domain-containing protein Huntingtin yeast partner E Huntingtin-interacting protein 13 Huntingtin-interacting protein E UNQ3041/PRO9857 De-AMPylase FICD protein protein human Homo sapiens Human MMLIPMASVMAVTEPKWVSVWSRFLWVTLLSMVLGSLLALLLPLGAVEEQCLAVLKGLYLLRSKPDRAQHAATKCTSPSTELSITSRGATLLVAKTKASPAGKLEARAALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP DIP protein Q9BVA6 original sequence version: 107 DIP protein Q9BVA6 original sequence version: 88 8393EAA46D61C48E vbht_barsr Protein adenylyltransferase VbhT Toxin VbhT B11C_100026 vbhT AMPylator VbhT protein protein barsr Bartonella schoenbuchensis (strain DSM 13525 / NCTC 13165 / R1) MRKYEGSNDPYTDPETGVMYNLLGIKDQARLERVESAFAYIRSFELGRTSISGKFDLDHMKKIHKKLFGDVYEWAGKTRLVDIVKDNSKFAHYTQIESYAPQITQQLAREQHLRGLDANEFSQRAGYYMGELNALHPFREGNGRTLREFIWQLAREAGYHIDWDRVERQEMTRASIESYYGNSDLMSALIRRNLTEFTVNRRVDVSQGINERVLSHIDIDKEWPQKGFNIAIQTTQQAPYLSSYTDTSNLEEKAQNALRNEQSYVDTFKELNDHLKTIYKDPQAAALKIEQTILAGKGDKLPDILAKAPNKVGELRGSDRLIDKLKSAGKERKAALYNVPLAISTIRRLQSFYKNSYEKHMDKLTREREQLKVEVPSLSQEAVAYMKNVEVGRNNYSKIPENINKEFVQLESALNRRFGKDVIYKRNFNLSKEIASKQTYDKKLVNELQTAIKFLQQRHIQKQNNLAITRTPSKGITR DIP protein E6Z0R3 original sequence version: 7 nmfic_neimb Protein adenylyltransferase NmFic AMPylator NmFic NMB0255 protein protein strain mc58 Neisseria meningitidis serogroup B MPSENPIGKTMKSIDEQSLHNARRLFESGDIDRIEVGTTAGLQQIHRYLFGGLYDFAGQIREDNISKGGFRFANAMYLKEALVKIEQMPERTFEEIIAKYVEMNIAHPFLEGNGRSTRIWLDLVLKKNLKKVVNWQNVSKTLYLQAMERSPVNDLELRFLLKDNLTDDVDNREIIFKGIEQSYYYEGYEKG DIP protein Q7DDR9 original sequence version: 51 p63000-1 Ras-related C3 botulinum toxin substrate 1 RAC1 Cell migration-inducing gene 5 protein Ras-like protein TC25 TC25 p21-Rac1 MIG5 Rac1A protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL DIP protein P63000-1 original sequence version: 44 DIP protein P63000 original sequence version: 133 DIP protein P63000-1 original sequence version: 128 DIP protein P63000 original sequence version: 90 DIP protein P63000 original sequence version: 91 DIP protein P63000 original sequence version: 92 DIP protein P63000 original sequence version: 80 DIP protein P63000 original sequence version: 106 DIP protein P63000 original sequence version: 95 DIP protein P63000 original sequence version: 112 DIP protein P63000 original sequence version: 128 DIP protein P63000 original sequence version: 137 DIP protein P63000 original sequence version: 157 DIP protein P63000 original sequence version: 116 DIP protein P63000-1 original sequence version: 124 mint ACEDF83A45E5EA67 vbha_barsr Antitoxin VbhA B11C_100027 protein protein barsr Bartonella schoenbuchensis (strain DSM 13525 / NCTC 13165 / R1) MLSEEEIEYRRRDARNALASQRLEGLEPDPQVVAQMERVVVGELETSDVIKDLMERIKREEI DIP protein E6Z0R4 original sequence version: 6 sofic_sheon Protein adenylyltransferase SoFic fic AMPylator SoFic SO_4266 protein protein sheon Shewanella oneidensis (strain MR-1) MEWQAEQAYNHLPPLPLDSKLAELAETLPILKACIPARAALAELKQAGELLPNQGLLINLLPLLEAQGSSEIENIVTTTDKLFQYAQEDSQADPMTKEALRYRTALYQGFTQLSNRPLCVTTALEICSTIKSVQMDVRKVPGTSLTNQATGEVIYTPPAGESVIRDLLSNWEAFLHNQDDVDPLIKMAMAHYQFEAIHPFIDGNGRTGRVLNILYLIDQQLLSAPILYLSRYIVAHKQDYYRLLLNVTTQQEWQPWIIFILNAVEQTAKWTTHKIAAARELIAHTTEYVRQQLPKIYSHELVQVIFEQPYCRIQNLVESGLAKRQTASVYLKQLCDIGVLEEVQSGKEKLFVHPKFVTLMTKDSNQFSRYAL DIP protein Q8E9K5 original sequence version: 53 p60953-2 Cell division control protein 42 homolog CDC42 G25K GTP-binding protein Placental protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL DIP protein P60953-2 original sequence version: 152 DIP protein P60953 original sequence version: 98 DIP protein P60953 original sequence version: 148 DIP protein P60953 original sequence version: 142 DIP protein P60953-2 original sequence version: 135 DIP protein P60953 original sequence version: 99 DIP protein P60953-2 original sequence version: 139 DIP protein P60953 original sequence version: 144 DIP protein P60953 original sequence version: 163 DIP protein P60953 original sequence version: 158 DIP protein P60953-2 original sequence version: 147 DIP protein P60953 original sequence version: 123 51A437E22A4D8FFF cdc42-ficd-1 7 14 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli 8 enzyme enzyme unspecified role unspecified role FIC domain Region 187-437 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9BVA6:p.Glu234Gly E234G mutation increasing rate mutation increasing interaction rate mutation increasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E G This feature has been corrected as a result of our quality control procedures. The original label was 'E234G'. Wed May 02 16:18:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu234gly' Tue Jun 30 15:40:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu234Gly' ecolx Escherichia coli ampylation ampylation reaction ampylation vbha_barsr-vbht-1 5 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role FIC domain Region 1-198 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction vbha_barsr-vbht-2 4 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role FIC domain Region 1-198 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ficd-rac1-1 6 11 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli 8 enzyme enzyme unspecified role unspecified role FIC domain Region 187-437 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9BVA6:p.Glu234Gly E234G mutation increasing rate mutation increasing interaction rate mutation increasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E G This feature has been corrected as a result of our quality control procedures. The original label was 'E234G'. Wed May 02 18:11:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu234gly' Tue Jun 30 19:39:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu234Gly' ecolx Escherichia coli ampylation ampylation reaction ampylation fic-1 1 13 putative self putative self unspecified role unspecified role Q8E9K5:p.Glu73Gly E73G mutation increasing rate mutation increasing interaction rate mutation increasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E G This feature has been corrected as a result of our quality control procedures. The original label was 'E73G'. Wed May 02 15:17:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu73gly' Tue Jun 30 19:41:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu73Gly' ecolx Escherichia coli ampylation ampylation reaction ampylation true ficd-5 3 8 putative self putative self unspecified role unspecified role FIC domain Region 187-437 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9BVA6:p.Glu234Gly E234G mutation increasing rate mutation increasing interaction rate mutation increasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E G This feature has been corrected as a result of our quality control procedures. The original label was 'E234G'. Wed May 02 19:02:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu234gly' Tue Jun 30 18:50:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu234Gly' ecolx Escherichia coli ampylation ampylation reaction ampylation true nmfic_neimb-1 2 10 putative self putative self unspecified role unspecified role Y183-AMP Y183-AMP oamptyr O4'-(phospho-5'-adenosine)-L-tyrosine MOD_RES O-AMP-tyrosine (2S)-2-amino-3-[4-(5'-adenosine phosphonoxy)phenyl]propanoic acid 5'-adenylic-O-tyrosine O4'-(phospho-5'-adenosine)-L-tyrosine O4'-L-tyrosine 5'-adenosine phosphodiester hydrogen 5'-adenylate tyrosine ester AMP binding site O-5'-Adenosylation ( of Tyrosine) OAMPTyr Phosphoadenosine modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain Y188-AMP Y188-AMP oamptyr O4'-(phospho-5'-adenosine)-L-tyrosine MOD_RES O-AMP-tyrosine (2S)-2-amino-3-[4-(5'-adenosine phosphonoxy)phenyl]propanoic acid 5'-adenylic-O-tyrosine O4'-(phospho-5'-adenosine)-L-tyrosine O4'-L-tyrosine 5'-adenosine phosphodiester hydrogen 5'-adenylate tyrosine ester AMP binding site O-5'-Adenosylation ( of Tyrosine) OAMPTyr Phosphoadenosine modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain Q7DDR9:p.[Ser182Ala;Glu186Ala] S182A/E186A mutation increasing rate mutation increasing interaction rate mutation increasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S182A/E186A'. Wed May 02 20:22:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser182ala,glu186ala' Tue Jun 30 16:59:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser182Ala;Glu186Ala]' Region 11-191 Region 11-191 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli ampylation ampylation reaction ampylation true Deletion of region 168-191 decreased the interaction rate/strength.