DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of Ddn, the deazaflavin-dependent nitroreductase from Mycobacterium tuberculosis involved in bioreductive activation of PA-824. Structure of Ddn, the deazaflavin-dependent nitroreductase from Mycobacterium tuberculosis involved in bioreductive activation of PA-824. Structure (London, England : 1993) 2012 imex curation Cellitti SE., Shaffer J., Jones DH., Mukherjee T., Gurumurthy M., Bursulaya B., Boshoff HI., Choi I., Nayyar A., Lee YS., Cherian J., Niyomrattanakit P., Dick T., Manjunatha UH., Barry CE., Spraggon G., Geierstanger BH. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cellitti SE., Shaffer J., Jones DH., Mukherjee T., Gurumurthy M., Bursulaya B., Boshoff HI., Choi I., Nayyar A., Lee YS., Cherian J., Niyomrattanakit P., Dick T., Manjunatha UH., Barry CE., Spraggon G., Geierstanger BH. DIP original experiment: DIP-249243X Structure (London, England : 1993) 2012 IMEx Structure of Ddn, the deazaflavin-dependent nitroreductase from Mycobacterium tuberculosis involved in bioreductive activation of PA-824. ddn_myctu Deazaflavin-dependent nitroreductase ddn F420H(2)-dependent quinone reductase Ddn Rv3547 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MPKSPPRFLNSPLSDFFIKWMSRINTWMYRRNDGEGLGGTFQKIPVALLTTTGRKTGQPRVNPLYFLRDGGRVIVAASKGGAEKNPMWYLNLKANPKVQVQIKKEVLDLTARDATDEERAEYWPQLVTMYPSYQDYQSWTDRTIPIVVCEP 41534E55D948FB52 ddn-1 1 2 unspecified role unspecified role unspecified role unspecified role Region 41-151 Region 41-151 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction