DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Mitochondrial hexokinase II (HKII) and phosphoprotein enriched in astrocytes (PEA15) form a molecular switch governing cellular fate depending on the metabolic state. Mitochondrial hexokinase II (HKII) and phosphoprotein enriched in astrocytes (PEA15) form a molecular switch governing cellular fate depending on the metabolic state. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Mergenthaler P., Kahl A., Kamitz A., van Laak V., Stohlmann K., Thomsen S., Klawitter H., Przesdzing I., Neeb L., Freyer D., Priller J., Collins TJ., Megow D., Dirnagl U., Andrews DW., Meisel A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mergenthaler P., Kahl A., Kamitz A., van Laak V., Stohlmann K., Thomsen S., Klawitter H., Przesdzing I., Neeb L., Freyer D., Priller J., Collins TJ., Megow D., Dirnagl U., Andrews DW., Meisel A. DIP original experiment: DIP-251482X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Mitochondrial hexokinase II (HKII) and phosphoprotein enriched in astrocytes (PEA15) form a molecular switch governing cellular fate depending on the metabolic state. Mitochondrial hexokinase II (HKII) and phosphoprotein enriched in astrocytes (PEA15) form a molecular switch governing cellular fate depending on the metabolic state. Mitochondrial hexokinase II (HKII) and phosphoprotein enriched in astrocytes (PEA15) form a molecular switch governing cellular fate depending on the metabolic state. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Mergenthaler P., Kahl A., Kamitz A., van Laak V., Stohlmann K., Thomsen S., Klawitter H., Przesdzing I., Neeb L., Freyer D., Priller J., Collins TJ., Megow D., Dirnagl U., Andrews DW., Meisel A. Only protein-protein interactions human Homo sapiens Human fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Mergenthaler P., Kahl A., Kamitz A., van Laak V., Stohlmann K., Thomsen S., Klawitter H., Przesdzing I., Neeb L., Freyer D., Priller J., Collins TJ., Megow D., Dirnagl U., Andrews DW., Meisel A. DIP original experiment: DIP-251483X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Mitochondrial hexokinase II (HKII) and phosphoprotein enriched in astrocytes (PEA15) form a molecular switch governing cellular fate depending on the metabolic state. Mitochondrial hexokinase II (HKII) and phosphoprotein enriched in astrocytes (PEA15) form a molecular switch governing cellular fate depending on the metabolic state. Mitochondrial hexokinase II (HKII) and phosphoprotein enriched in astrocytes (PEA15) form a molecular switch governing cellular fate depending on the metabolic state. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Mergenthaler P., Kahl A., Kamitz A., van Laak V., Stohlmann K., Thomsen S., Klawitter H., Przesdzing I., Neeb L., Freyer D., Priller J., Collins TJ., Megow D., Dirnagl U., Andrews DW., Meisel A. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mergenthaler P., Kahl A., Kamitz A., van Laak V., Stohlmann K., Thomsen S., Klawitter H., Przesdzing I., Neeb L., Freyer D., Priller J., Collins TJ., Megow D., Dirnagl U., Andrews DW., Meisel A. DIP original experiment: DIP-251484X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Mitochondrial hexokinase II (HKII) and phosphoprotein enriched in astrocytes (PEA15) form a molecular switch governing cellular fate depending on the metabolic state. hxk2_mouse Hexokinase-2 Hk2 Hexokinase type II protein protein mouse Mus musculus Mouse MIASHMIACLFTELNQNQVQKVDQYLYHMRLSDETLLEISRRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLRVRVTDNGLQRVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKEKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVDLIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDQNCEIGLIVGTGSNACYMEEMRHIDMVEGDEGRMCINMEWGAFGDDGTLNDIRTEFDREIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKAELLFQGKLSPELLTTGSFETKDVSDIEDDKDGIQKAYQILVRLGLSPLQEDCVATHRICQIVSTRSASLCAATLAAVLWRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKAVRRLVPDCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLESLKLSHEQLLEVKRRMKVEMEQGLSKETHEAAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVRNGKRRGVEMHNKIYSIPQEVMHGTGEELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDQSILLKWTKGFKASGCEGEDVVTLLKEAIRRREEFDLDVVAVVNDTVGTMMTCGYEDPHCEVGLIVGTGSNACYMEEMRNVELVDGEEGRMCVNMEWGAFGDNGCLDDLRTVFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLALLQVRAILRHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAAVVDKIRENRGLDNLKVTVGVDGTLYKLHPHFAKVMHETVRDLAPKCDVSFLESEDGSGKGAALITAVACRIREAGQR DIP protein O08528 original sequence version: 109 mint 44293E7A92D724B3 pea15_mouse Astrocytic phosphoprotein PEA-15 Pea15 Pea15a 15 kDa phosphoprotein enriched in astrocytes protein protein mouse Mus musculus Mouse MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEEELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA DIP protein Q62048 original sequence version: 105 mint Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm. Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Regulates glucose transport by controlling both the content of SLC2A1 glucose transporters on the plasma membrane and the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface 780F93A40B2834A8 vdac1_rat Voltage-dependent anion-selective channel protein 1 Vdac1 Outer mitochondrial membrane protein porin 1 protein protein rat Rattus norvegicus (Rat) Rat MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVNGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETSKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQVDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA DIP protein Q9Z2L0 original sequence version: 87 D32B05B8A8D75732 hxk2_rat Hexokinase-2 Hexokinase type II Hk2 Hexokinase-B protein protein rat Rattus norvegicus (Rat) Rat MIASHMIACLFTELNQNQVQKVDQFLYHMRLSDETLLEISRRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLRVRVTDNGLQRVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKEKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVDLIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDQNCEIGLIVGTGSNACYMEEMRHIDMVEGDEGRMCINMEWGAFGDDGTLNDIRTEFDREIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKAELLFQGKLSPELLTTGSFETKDVSDIEEDKDGIEKAYQILMRLGLNPLQEDCVATHRICQIVSTRSASLCAATLAAVLWRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKAVRRLVPDCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLESLKLSHEQLLEVKRRMKVEMEQGLSKETHAVAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVRNGKRRGVEMHNKIYSIPQEVMHGTGEELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDQSILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGYEDPHCEVGLIVGTGSNACYMEEMRNVELVDGEEGRMCVNMEWGAFGDNGCLDDLRTVFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLALLQVRAILRHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAAVVDKIRENRGLDNLKVTVGVDGTLYKLHPHFAKVMHETVRDLAPKCDVSFLESEDGSGKGAALITAVACRIREAGQR DIP protein P27881 original sequence version: 104 764EC189C0F90987 pea15_rat Astrocytic phosphoprotein PEA-15 Pea15 15 kDa phosphoprotein enriched in astrocytes protein protein rat Rattus norvegicus (Rat) Rat MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA DIP protein Q5U318 original sequence version: 60 mint Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm. Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Regulates glucose transport by controlling both the content of SLC2A1 glucose transporters on the plasma membrane and the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface 8D0F93A40B299FB2 hk2-pea15-1 1 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association hk2-pea15-2 2 5 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Venus-tag Venus-tag venus venus fluorescent protein tag venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 4 unspecified role unspecified role fluorescence donor fluorescence donor Cerulean-tag Cerulean-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human proximity proximity close-contact colocalization neighbourhood interaction hk2-pea15-3 3 8 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 6 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 7 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat association association