DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Nature 2012 imex curation Watson PJ., Fairall L., Santos GM., Schwabe JW. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Watson PJ., Fairall L., Santos GM., Schwabe JW. DIP original experiment: DIP-249524X Nature 2012 IMEx Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Nature 2012 imex curation Watson PJ., Fairall L., Santos GM., Schwabe JW. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Watson PJ., Fairall L., Santos GM., Schwabe JW. DIP original experiment: DIP-249523X Nature 2012 IMEx Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Nature 2012 imex curation Watson PJ., Fairall L., Santos GM., Schwabe JW. Only protein-protein interactions human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Watson PJ., Fairall L., Santos GM., Schwabe JW. DIP original experiment: DIP-249522X Nature 2012 IMEx Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Nature 2012 imex curation Watson PJ., Fairall L., Santos GM., Schwabe JW. Only protein-protein interactions human Homo sapiens Human deacetylase assay deacetylase assay predetermined predetermined participant predetermined Watson PJ., Fairall L., Santos GM., Schwabe JW. DIP original experiment: DIP-249525X Nature 2012 IMEx Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Nature 2012 imex curation Watson PJ., Fairall L., Santos GM., Schwabe JW. Only protein-protein interactions human Homo sapiens Human x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Watson PJ., Fairall L., Santos GM., Schwabe JW. DIP original experiment: DIP-249521X Nature 2012 IMEx Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. Nature 2012 imex curation Watson PJ., Fairall L., Santos GM., Schwabe JW. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Watson PJ., Fairall L., Santos GM., Schwabe JW. DIP original experiment: DIP-249526X Nature 2012 IMEx Structure of HDAC3 bound to co-repressor and inositol tetraphosphate. hdac3_human Histone deacetylase 3 HDAC3 RPD3-2 SMAP45 protein protein human Homo sapiens Human MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI DIP protein O15379 original sequence version: 159 DIP protein O15379 original sequence version: 161 DIP protein O15379 original sequence version: 162 DIP protein O15379 original sequence version: 89 DIP protein O15379 original sequence version: 156 DIP protein O15379 original sequence version: 176 DIP protein O15379 original sequence version: 170 DIP protein O15379-1 original sequence version: 170 DIP protein O15379 original sequence version: 127 DIP protein O15379-1 original sequence version: 128 DIP protein O15379 original sequence version: 119 94485C1EBDCF5AD0 ncor2_human Nuclear receptor corepressor 2 NCOR2 CTG26 Silencing mediator of retinoic acid and thyroid hormone receptor Thyroid-, retinoic-acid-receptor-associated corepressor T3 receptor-associating factor CTG repeat protein 26 SMAP270 protein protein human Homo sapiens Human MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHSYLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVDREITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQKFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSGLSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQQQQQQQQQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANSEEAITPQQSAELASMELNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKMEKERNARRKKKKAPAAASEEAAFPPVVEDEEMEASGVSGNEEEMVEEAEALHASGNEVPRGECSGPATVNNSSDTESIPSPHTEAAKDTGQNGPKPPATLGADGPPPGPPTPPPEDIPAPTEPTPASEATGAPTPPPAPPSPSAPPPVVPKEEKEEETAAAPPVEEGEEQKPPAAEELAVDTGKAEEPVKSECTEEAEEGPAKGKDAEAAEATAEGALKAEKKEGGSGRATTAKSSGAPQDSDSSATCSADEVDEAEGGDKNRLLSPRPSLLTPTGDPRANASPQKPLDLKQLKQRAAAIPPIQVTKVHEPPREDAAPTKPAPPAPPPPQNLQPESDAPQQPGSSPRGKSRSPAPPADKEAFAAEAQKLPGDPPCWTSGLPFPVPPREVIKASPHAPDPSAFSYAPPGHPLPLGLHDTARPVLPRPPTISNPPPLISSAKHPSVLERQIGAISQGMSVQLHVPYSEHAKAPVGPVTMGLPLPMDPKKLAPFSGVKQEQLSPRGQAGPPESLGVPTAQEASVLRGTALGSVPGGSITKGIPSTRVPSDSAITYRGSITHGTPADVLYKGTITRIIGEDSPSRLDRGREDSLPKGHVIYEGKKGHVLSYEGGMSVTQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGRAISSASIEGLMGRAIPPERHSPHHLKEQHHIRGSITQGIPRSYVEAQEDYLRREAKLLKREGTPPPPPPSRDLTEAYKTQALGPLKLKPAHEGLVATVKEAGRSIHEIPREELRHTPELPLAPRPLKEGSITQGTPLKYDTGASTTGSKKHDVRSLIGSPGRTFPPVHPLDVMADARALERACYEESLKSRPGTASSSGGSIARGAPVIVPELGKPRQSPLTYEDHGAPFAGHLPRGSPVTTREPTPRLQEGSLSSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVSGVDLYRSHIPLAFDPTSIPRGIPLDAAAAYYLPRHLAPNPTYPHLYPPYLIRGYPDTAALENRQTIINDYITSQQMHHNAATAMAQRADMLRGLSPRESSLALNYAAGPRGIIDLSQVPHLPVLVPPTPGTPATAMDRLAYLPTAPQPFSSRHSSSPLSPGGPTHLTKPTTTSSSERERDRDRERDRDREREKSILTSTTTVEHAPIWRPGTEQSSGSSGGGGGSSSRPASHSHAHQHSPISPRTQDALQQRPSVLHNTGMKGIITAVEPSTPTVLRSTSTSSPVRPAATFPPATHCPLGGTLDGVYPTLMEPVLLPKEAPRVARPERPRADTGHAFLAKPPARSGLEPASSPSKGSEPRPLVPPVSGHATIARTPAKNLAPHHASPDPPAPPASASDPHREKTQSKPFSIQELELRSLGYHGSSYSPEGVEPVSPVSSPSLTHDKGLPKHLEELDKSHLEGELRPKQPGPVKLGGEAAHLPHLRPLPESQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGAPARGSPHSEGGKRSPEPNKTSVLGGGEDGIEPVSPPEGMTEPGHSRSAVYPLLYRDGEQTEPSRMGSKSPGNTSQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYNISQPGTEIFNMPAITGTGLMTYRSQAVQEHASTNMGLEAIIRKALMGKYDQWEESPPLSANAFNPLNASASLPAAMPITAADGRSDHTLTSPGGGGKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAGSTPFPYNPLIMRLQAGVMASPPPPGLPAGSGPLAGPHHAWDEEPKPLLCSQYETLSDSE DIP protein Q9Y618 original sequence version: 166 DIP protein Q9Y618-1 original sequence version: 119 DIP protein Q9Y618-1 original sequence version: 155 DIP protein Q9Y618 original sequence version: 134 DIP protein Q9Y618 original sequence version: 138 70A89C9A19612AAD hdac3-ncor2-1 5 8 unspecified role unspecified role unspecified role unspecified role deacetylase activation domain Region 389-480 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 7 unspecified role unspecified role unspecified role unspecified role Region 1-376 Region 1-376 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction hdac3-ncor2-3 2 8 unspecified role unspecified role prey prey deacetylase activation domain Region 389-480 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 7 unspecified role unspecified role bait bait O15379:p.Arg265Pro R265P mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R P This feature has been corrected as a result of our quality control procedures. The original label was 'R265P'. Wed May 02 15:29:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg265pro' Tue Jun 30 18:01:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg265Pro' O15379:p.[His17Cys;Gly21Ala;Lys25Ile] H17C/G21A/K25I mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K I certain certain sequence position certain certain certain sequence position certain G A certain certain sequence position certain certain certain sequence position certain H C This feature has been corrected as a result of our quality control procedures. The original label was 'H17C/G21A/K25I'. Wed May 02 14:27:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his17cys,gly21ala,lys25ile' Tue Jun 30 16:19:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His17Cys;Gly21Ala;Lys25Ile]' O15379:p.[Arg265Pro;Leu266Met] R265P/L266M mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L M certain certain sequence position certain certain certain sequence position certain R P This feature has been corrected as a result of our quality control procedures. The original label was 'R265P/L266M'. Wed May 02 18:47:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg265pro,leu266met' Tue Jun 30 18:08:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg265Pro;Leu266Met]' O15379:p.[His17Cys;Gly21Ala;Lys25Ile;Arg265Pro;Leu266Met] H17C/G21A/K25I/R265P/L266M mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L M certain certain sequence position certain certain certain sequence position certain R P certain certain sequence position certain certain certain sequence position certain K I certain certain sequence position certain certain certain sequence position certain G A certain certain sequence position certain certain certain sequence position certain H C This feature has been corrected as a result of our quality control procedures. The original label was 'H17C/G21A/K25I/R265P/L266M'. Wed May 02 16:50:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his17cys,gly21ala,lys25ile,arg265pro,leu266met' Tue Jun 30 20:09:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His17Cys;Gly21Ala;Lys25Ile;Arg265Pro;Leu266Met]' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association hdac3-ncor2-4 4 8 unspecified role unspecified role unspecified role unspecified role deacetylase activation domain Region 389-480 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 7 unspecified role unspecified role unspecified role unspecified role O15379:p.Arg265Pro R265P mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R P This feature has been corrected as a result of our quality control procedures. The original label was 'R265P'. Wed May 02 20:18:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg265pro' Tue Jun 30 20:13:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg265Pro' O15379:p.[His17Cys;Gly21Ala;Lys25Ile] H17C/G21A/K25I mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K I certain certain sequence position certain certain certain sequence position certain G A certain certain sequence position certain certain certain sequence position certain H C This feature has been corrected as a result of our quality control procedures. The original label was 'H17C/G21A/K25I'. Wed May 02 15:12:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his17cys,gly21ala,lys25ile' Tue Jun 30 17:22:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His17Cys;Gly21Ala;Lys25Ile]' O15379:p.[Arg265Pro;Leu266Met] R265P/L266M mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L M certain certain sequence position certain certain certain sequence position certain R P This feature has been corrected as a result of our quality control procedures. The original label was 'R265P/L266M'. Wed May 02 19:06:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg265pro,leu266met' Tue Jun 30 16:45:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg265Pro;Leu266Met]' O15379:p.[His17Cys;Gly21Ala;Lys25Ile;Arg265Pro;Leu266Met] H17C/G21A/K25I/R265P/L266M mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L M certain certain sequence position certain certain certain sequence position certain R P certain certain sequence position certain certain certain sequence position certain K I certain certain sequence position certain certain certain sequence position certain G A certain certain sequence position certain certain certain sequence position certain H C This feature has been corrected as a result of our quality control procedures. The original label was 'H17C/G21A/K25I/R265P/L266M'. Wed May 02 19:46:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his17cys,gly21ala,lys25ile,arg265pro,leu266met' Tue Jun 30 16:34:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His17Cys;Gly21Ala;Lys25Ile;Arg265Pro;Leu266Met]' human Homo sapiens Human direct interaction direct interaction hdac3-ncor2-5 3 8 unspecified role unspecified role unspecified role unspecified role deacetylase activation domain Region 389-480 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 7 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction hdac3-1 1 7 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction ncor2-hdac3-1 6 8 unspecified role unspecified role bait bait deacetylase activation domain Region 389-480 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 7 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association