DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Two surfaces on the histone chaperone Rtt106 mediate histone binding, replication, and silencing. Two surfaces on the histone chaperone Rtt106 mediate histone binding, replication, and silencing. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Zunder RM., Antczak AJ., Berger JM., Rine J. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zunder RM., Antczak AJ., Berger JM., Rine J. DIP original experiment: DIP-251463X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Two surfaces on the histone chaperone Rtt106 mediate histone binding, replication, and silencing. Two surfaces on the histone chaperone Rtt106 mediate histone binding, replication, and silencing. Two surfaces on the histone chaperone Rtt106 mediate histone binding, replication, and silencing. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Zunder RM., Antczak AJ., Berger JM., Rine J. Only protein-protein interactions ecolx Escherichia coli pull down pull down western blot western blot Immuno blot Immuno blot Zunder RM., Antczak AJ., Berger JM., Rine J. DIP original experiment: DIP-251464X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Two surfaces on the histone chaperone Rtt106 mediate histone binding, replication, and silencing. Two surfaces on the histone chaperone Rtt106 mediate histone binding, replication, and silencing. Two surfaces on the histone chaperone Rtt106 mediate histone binding, replication, and silencing. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Zunder RM., Antczak AJ., Berger JM., Rine J. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zunder RM., Antczak AJ., Berger JM., Rine J. DIP original experiment: DIP-251465X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Two surfaces on the histone chaperone Rtt106 mediate histone binding, replication, and silencing. pob3_yeast FACT complex subunit POB3 YML069W Facilitates chromatin transcription complex subunit POB3 POB3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTDFDRIYLNQSKFSGRFRIADSGLGWKISTSGGSAANQARKPFLLPATELSTVQWSRGCRGYDLKINTKNQGVIQLDGFSQDDYNLIKNDFHRRFNIQVEQREHSLRGWNWGKTDLARNEMVFALNGKPTFEIPYARINNTNLTSKNEVGIEFNIQDEEYQPAGDELVEMRFYIPGVIQTNVDENMTKKEESSNEVVPKKEDGAEGEDVQMAVEEKSMAEAFYEELKEKADIGEVAGDAIVSFQDVFFTTPRGRYDIDIYKNSIRLRGKTYEYKLQHRQIQRIVSLPKADDIHHLLVLAIEPPLRQGQTTYPFLVLQFQKDEETEVQLNLEDEDYEENYKDKLKKQYDAKTHIVLSHVLKGLTDRRVIVPGEYKSKYDQCAVSCSFKANEGYLYPLDNAFFFLTKPTLYIPFSDVSMVNISRAGQTSTSSRTFDLEVVLRSNRGSTTFANISKEEQQLLEQFLKSKNLRVKNEDREVQERLQTALGSDSDEEDINMGSAGEDDESVDEDFQVSSDNDADEVAEEFDSDAALSDAEGGSDEERPSKKPKVE 02C04F620C7B1450 02C04F620C7B1450 rt106_yeast Histone chaperone RTT106 Regulator of Ty1 transposition protein 106 YNL206C N1346 RTT106 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKLFLDELPESLSRKIGTVVRVLPSSLEIFEELYKYALNENSNDRSGRHKKPRIDVSSDLLKTDEISETNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKNLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVNSTLVDTDAEKINSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLFDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVKRKQMKDKSMSEELKAKSKSKGQATDGTADQPSILQEATRQMQDEKKAGVFSDDDEENDQNFEAESDLSDGSGQESSDGAEDGEEAEEDDEEDDEEEDKKGQSALNRDNSFASINGQPEQELQYKEFKEPLELEDIPIEIDNDDDEDDEDGSGVEYD 79CACA659A7F4F4D 79CACA659A7F4F4D h3_yeast Histone H3 SIN2 YNL031C N2749 HHT1 YBR010W YBR0201 HHT2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS A6115FEB480AC67A A6115FEB480AC67A rtt106-h3-2 1 6 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range P40161:p.Ser80Glu S80E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S E This feature has been corrected as a result of our quality control procedures. The original label was 'S80E'. Wed May 02 19:59:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser80glu' Tue Jun 30 17:47:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser80Glu' P40161:p.Arg86Ala R86A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R86A'. Wed May 02 20:10:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg86ala' Tue Jun 30 19:34:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg86Ala' P40161:p.Thr265Glu T265E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T E This feature has been corrected as a result of our quality control procedures. The original label was 'T265E'. Wed May 02 19:58:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr265glu' Tue Jun 30 18:10:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr265Glu' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pob3-h3-1 3 4 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q04636:p.Thr252Glu T252E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T E This feature has been corrected as a result of our quality control procedures. The original label was 'T252E'. Wed May 02 16:46:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr252glu' Tue Jun 30 17:50:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr252Glu' Q04636:p.Gln308Lys Q308K mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q K This feature has been corrected as a result of our quality control procedures. The original label was 'Q308K'. Wed May 02 17:34:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln308lys' Tue Jun 30 19:34:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln308Lys' Q04636:p.Thr251Glu T251E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T E This feature has been corrected as a result of our quality control procedures. The original label was 'T251E'. Wed May 02 15:12:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr251glu' Tue Jun 30 19:14:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr251Glu' Q04636:p.Phe249Glu F249E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F249E'. Wed May 02 19:40:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe249glu' Tue Jun 30 19:03:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe249Glu' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rtt106-h3-3 2 6 unspecified role unspecified role prey prey ecolx Escherichia coli 5 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P40161:p.Ser80Glu S80E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S E This feature has been corrected as a result of our quality control procedures. The original label was 'S80E'. Wed May 02 17:25:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser80glu' Tue Jun 30 18:08:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser80Glu' P40161:p.Arg86Ala R86A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R86A'. Wed May 02 18:01:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg86ala' Tue Jun 30 15:55:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg86Ala' P40161:p.Thr265Glu T265E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T E This feature has been corrected as a result of our quality control procedures. The original label was 'T265E'. Wed May 02 18:18:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr265glu' Tue Jun 30 18:50:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr265Glu' ecolx Escherichia coli physical association physical association