DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255356X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255374X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255375X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255363X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255361X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255370X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255371X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255367X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255368X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255377X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255376X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255357X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255369X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip mudpit multidimensional protein identification technology mudpit Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255354X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255364X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255359X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255355X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255362X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255366X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255373X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255358X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255365X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255372X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Nature structural & molecular biology 2011 imex curation Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255360X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. q95xs0_caeel eri-5 CELE_Y38F2AR.1 Y38F2AR.1 protein protein caeel Caenorhabditis elegans MLSEEPYETYHPEFPDPEIRRIALKSSAVVELLRIESPSSFFCRPVDHVTDDQLLIREPYRLTTRIIDFSAGNMAMAPLRPRVFARCLILKNLELIEAARIFFIDSAVTANVSWKCLFQIDENLKFHPWQAMHCTLGRLVHLSDSWTDTQCTEFRNIVSKFAKFQITANQCDVDFRSDRPSLLVNLYGLPNGTEIDKKVAIEEICAVSMQNVMVSQFPTNFMVNPKLEELDKEQDHLDVILLEEFRRDLPADWAHEPPADYREDDADWDILQCHVAEWNDTALEQFRRADGSFWAMLEPSCTVSPWEMHVTPILAPEKMSDNEHWIFEQLVKNSENQQKIDDFYSNLKNQRPLEMEEIKFALQTGRTYVMATIKNRQKSSAQWLRCEIIDFLPNANVALRYVDLGTRGILKLKNLHRMHIEHTKIAPACIEIGRFLDDDLSMADSEMEWNTHFWREIVPYDVPIVVGPDMEFLETGKLQFSQIRVAGDEDDENLLDKIPSPSPFFTERSDDLRTQKEDDDDGNVSDDKDSG DIP protein Q95XS0 original sequence version: 59 8786C71FEE93E751 q19731_caeel ekl-1 CELE_F22D6.6 F22D6.6 protein protein caeel Caenorhabditis elegans MIAVGLRLTDEVFPNPEEPIAKLPTGNENPEMLLDGVNKDGKTRIKRIVLSRSANVEFLRAESPSRIWVRLTNHITDSALTFREPFELTQKTTFKIGDYALAPTDERVYRRCRIVDVCRNNELLKVFFIDDAVIAWVQPECLGELDQHYMYYPWQAIQVSMFGATPTVDVNRSTEQLWSPIICDQLSKVLEQFFILRVEVVLSTVVFNDYAKPIPVNLFGIEADIDEKDQIRRAIEIGPILERQEPVGISFPEFFDAAYHQVFEVAERETIPNEALEIHRSFPTDWKKTSISEDQMKEEKEKALFSKNSLIPEMEHSDWDPRQNSIEMLSIDQLEEKFKFPYDSDVAPAIMLAVEGRCTKSPFEWYARPIVKTGRNANGEMVIWNDEEQLKEVDPVDWMIYGNDQLLSMAEQLDTYYSNPKNRKPLKAEEIQSMRKEKRDVFAVCAVNEEKAMYTGEWQRVLIVECDTFAEVRFLDSGGRDMVLTGSLYKIHRQHCRFPPMCLRLSMHGITSSESVVRKWTSAETSRFRTCLREDVPIFINIDDIAPLILPPDDKKDPRAHMAKHVLMVSDVSYMDESKSLLDRFTDKDEAVRAAFSQKEPIEWPN DIP protein Q19731 original sequence version: 71 g5ee53_caeel RNA-directed RNA polymerase rrf-3 CELE_F10B5.7 F10B5.7 protein protein caeel Caenorhabditis elegans MLPFDNDDSSDDATTSVRPKHPRGVPQSQSTFPRGRSNFSSGTLPNRKTECTPVNTLTIGHSNKMLLTTFRMDRNSKSKSEVDVQEQPVHSSSSAFPGNHLNNFSYPVNRGYLRDYLLQSQRPSTSKPVDCSVLKRHSLPSTHILYEKTKHRGGVNIEEQEKLVRMLWAAAEESETVAKTRQFSKKQAIELNFDAKLIGSMNNDCFGYCRAHMENIKDVLKTHLKLSKVDEVNWIKVGMVPRAAYEDKSYVIDAHLVLTPNGEVEDENELFSEFASSFTSRITGMLHDQVFLEVPKMHTLFTKITPQHMDINISAIAIGNCPNSGLFLVRGDFISQENTVCSVKLQSHHNADASRENSSFKVAGSNKYLSYARFEHDKRLAVVYFGVRLAEFADDGLDHAGFRLNLYYNLFVRIVVDMSHETTNSIYIQMKNPPHLWEGIPKNTIFHPSKSKVLNMETCTEWTRVLSWPGDAEGRGVGCTSEAFSQSSWIRLTMRKDDDNDSVSSTQLMDIVTRLSARSKAKVMFGSIFSIRRKLAPSPAFHSLGSFRANYALQALITRGSVFTDQLFDATDENIPSSDNDNDEDDDDDVDDTKKPMELVHEPLFLKLVRRGMKECSQATEETLEQLLNAFDERRQIDVVTAFTTMYQSRKIQYERLLKGESLQDVGLAKPLPKNCVSVAKVIVTPSRILLMAPEVMMVNRVVRRFGPDYALRCVFRDDNLGRLAIRDFSINNIDHMSNIVTEGIYLTLKNGIQVADRVYSFLGWSNSQMRDQGCYLYAPRVNALTGEVTGTVEDIRVWMGDFRDAISVPKMMSRMGQCFTQAQPTVRLERHHWIVEPDIEGGVENKYCFSDGCGRISIKLATHISKILQLKEVPACFQVRFKGFKGILVIDPTIDDIINMPKVIFRKSQQKFGEGGGELQDEYLEVVKYAMPSPVCLNRPFITILDQVSEKQSASSHRRITNRVHYYLERELCSLSNMLINENQAAEELVNRTNLAIDWNAASKRAGFELSVDPLIRDMLFSIYRYNIIHHISKAKIFLPPSLGRSMYGVVDETGLLQYGQVFIQYSPSIRQTSNRPILKTGKVLITKNPCHVPGDVRVFDAVWQPALAHLVDVVVFPQHGPRPHPDEMAGSDLDGDEYSIIWDQEMLLDYNEEAMVFPSSSAAEEDKEPTTDDMVEFFLRYLQQDSIGRMSHAHLAYADLHGLFHENCHAIALKCAVAVDFPKSGVPAEPLSSFEQCEMTPDYMMSGGKPMYYSTRLNGQLHRKARKVEEVLEEFETRGSVFEREYDKLICPEDVDVFFGNEIKLVQTLTLRDEYVDRMQQLLDEYGIEDEASVVSGHAASIKRLAGMERDDYSFYHTDKVVELRYEKLYAVFRAKFFEEFGGEEINIENDGKNTRLKCTKAMHEKIRQWYFVAYVQPKINKAGRCIGQSLPWVAWDALCDLRRQLMLDKNDAVLRGKYPIAARLEEEIENSIERQFDKFLKLKDLIESHKDALFLRRYVYFYGDQIIKMLFILKVWLERENVLPSSVLSIWQLGRLLIRLGLGDLLGNPTIDYEKSLLMPTTMFQQWISKKEDADEAPILRNFDMGTMMLEFLRYLASQSFASAESISLRVFYEKDIVEPILTKSAQWMPLHLIAYRTFHSIAVSGRFDALHLDDEDAVDQITESKDPILVNESLFSSRNYNDDYPISRSRILQSLKDWSGVKEIIPREITGTRKSDMIYVTSVGTVLARQRLARLLLLSGETIRDAIANNVVPNEVRDEFL DIP protein G5EE53 original sequence version: 2 7FFF0C2F37BA4EA9 dus11_caeel RNA/RNP complex-1-interacting phosphatase homolog pir-1 Dual specificity protein phosphatase 11 homolog Phosphatase interacting with RNA/RNP complex-1 T23G7.5 protein protein caeel Caenorhabditis elegans MSNYHHNHNYQHRPRGYERLPGKRLPDRWNIYDNVGRDIDGTRFVPFKTPLDSSFFDGKNMPVELQFGVKTLISLAQQANKQIGLVIDLTNTDRYYKKTEWADHGVKYLKLNCPGHEVNEREDLVQDFINAVKEFVNDKENDGKLIGVHCTHGLNRTGYLICRYMIDVDNYSASDAISMFEYYRGHPMEREHYKKSLYEAERKKKYGKSSGKSSGNSADSTISSEQLHRNNSQ DIP protein Q22707 original sequence version: 79 1677EE45A8263239 o44406-1 3'-5' exonuclease eri-1 eri-1b eri-1 Enhanced RNAi protein T07A9.5 protein protein caeel Caenorhabditis elegans MSADEPSPEDEKYLESLRDLLKISQEFDASNAKQNDEPEKTAVEVESAETRTDESEKSIDIPREQQLLPSERVEPLKSMVEPEYVKKVIRQMDTMTAEQLKQALMKIKVSTGGNKKTLRKRVAQYYRKENALLNRKMEPNADKTARFFDYLIAIDFECTCVEIIYDYPHEIIELPAVLIDVREMKIISEFRTYVRPVRNPKLSEFCMQFTKIAQETVDAAPYFREALQRLYTWMRKFNLGQKNSRFAFVTDGPHDMWKFMQFQCLLSNIRMPHMFRSFINIKKTFKEKFNGLIKGNGKSGIENMLERLDLSFVGNKHSGLDDATNIAAIAIQMMKLKIELRINQKCSYKENQRSAARKDEERELEDAANVDLTSVDISRRDFQLWMRRLPLKLSSVTRREFINEEYLDCDSCDDLTDDKNDEAAFQEKMAIREYLENKQTEDFAKIAAERGIFKIGEIKSYQTARPIIEDDDVDVESEEEDYGTEFEMLEVVERMPPVSSTLHTEVDLDAVWERDGGSDSERENLSNAPSLHEFPSSSTSSPHATSEHVTSSSPLHIDDDVDRVLNAPPKNSLASSSNRSSF DIP protein O44406-1 original sequence version: 80 BFE82B9EF52DCED6 q93413_caeel drh-3 CELE_D2005.5 D2005.5 protein protein caeel Caenorhabditis elegans MQPTAIRLEDYDKSKLRLPFESPYFPAYFRLLKWKFLDVCVESTRNNDIGYFKLFESLFPPGKLEEIARMIIDEPTPVSHDPDMIKIRNADLDVKIRKQAETYVTLRHAHQQKVQRRRFSECFLNTVLFDEKGLRIADEVMFNYDKELYGYSHWEDLPDGWLTAETFKNKFYDEEEVTNNPFGYQKLDRVAGAARGMIIMKHLKSNPRCVSETTILAFEVFNKGNHQLSTDLVEDLLTEGPAFELKIENGEEKKYAVKKWSLHKTLTMFLAIIGFKSNDKKEKNEHEEWYYGFIDAMKNDPANRAALYFLDKNWPEELEEREKERDRIRLTLLKSQRTNEEAVGEDVCTTIRPQPKDSGYNPDAVVTELVLRTYQEELVQPALEGKNCVIVAPTGSGKTEVAIYAALKHIEERTSQGKPSRVVLLVPKIPLVGQQKDRFLKYCNGMYEVNGFHGSESSVSGTGRRDEVIATHVSVMTPQILINMLQSVRQNERLYVSDFSMMIFDEVHKAAKNHPYVLINQMVQEWKYEKPQIIGLTASLSVKVDGQKDENQMLNDIYNMLALINAPHLSTITRQSSIDELNEHVGKPDDSVELCLPAKENILRDYIERYLNHAHGKFLEELASMSKSTGRNNTIPPNMINTFKKNQPKNYEYYDSLLQGIIQELNKLNVPEKWNSQTWAKYMKVYLEARGIVDLMPAMVAFKYMEKAIGKLNESHSETVEYSTFIKDHDTLKQTIQSVEPEIVLRLKNTLTNQFHVAPESRVIIFVTQRSTAQRVSDFLNESKVLDQFGNYGEQMVGYVLGTNKQGAVQQTSQEQQLTLDKFNNGRLKVIVATSVVEEGLDVTACNLIIKYNCSSGSAIQLVQQRGRARAKNSRSVLLSVKSSINETETNALISEKYMRLCVKKITENGEKQLAAEVKRVAELNAAERKRNLEEQLNLRLRHENKIYKLMCSNCSKEFCKSIYIKKVFSNYMVFDPSVWRFLHVESKRKVSKYLSEDNQPLSDIKCFHCKLDVGRAYKIRGTYLPQLSVKALTFVQESDYSSMTKAKWSDVEQDLFYISEAIEDDFRIMLNALSDTEENIEKKIVLDLDSRQHNKQLEMKRFHIQQEPPTKGVAPEAQ DIP protein Q93413 original sequence version: 96 EDBDA9994166DF5A eri1_caeel 3'-5' exonuclease eri-1 Enhanced RNAi protein eri-1 T07A9.5 protein protein caeel Caenorhabditis elegans MSADEPSPEDEKYLESLRDLLKISQEFDASNAKQNDEPEKTAVEVESAETRTDESEKSIDIPREQQLLPSERVEPLKSMVEPEYVKKVIRQMDTMTAEQLKQALMKIKVSTGGNKKTLRKRVAQYYRKENALLNRKMEPNADKTARFFDYLIAIDFECTCVEIIYDYPHEIIELPAVLIDVREMKIISEFRTYVRPVRNPKLSEFCMQFTKIAQETVDAAPYFREALQRLYTWMRKFNLGQKNSRFAFVTDGPHDMWKFMQFQCLLSNIRMPHMFRSFINIKKTFKEKFNGLIKGNGKSGIENMLERLDLSFVGNKHSGLDDATNIAAIAIQMMKLKIELRINQKCSYKENQRSAARKDEERELEDAANVDLTSVDISRRDFQLWMRRLPLKLSSVTRREFINEEYLDCDSCDDLTDDKNDEAAFQEKMAIREYLENKQTEDFAKIAAERGIFKIGEIKSYQTARPIIEDDDVDVESEEEDYGTEFEMLEVVERMPPVSSTLHTEVDLDAVWERDGGSDSERENLSNAPSLHEFPSSSTSSPHATSEHVTSSSPLHIDDDVDRVLNAPPKNSLASSSNRSSF DIP protein O44406 original sequence version: 80 BFE82B9EF52DCED6 dcr1_caeel Endoribonuclease dcr-1 dcr-1 eri-4 let-740 K12H4.8 protein protein caeel Caenorhabditis elegans MVRVRADLQCFNPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQGGKRAFFVVEKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDLIRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLTASLIKAKVAPEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDTVIEIFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEKELGKIIKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEALRPYVPQRVIRLFEILETFNPEFQKERMKLEKAEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPDYVVGASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDRPLDMRSYVQSKGRARRAGSRYVITVEEKDTAACDSDLKDFQQIEKILLSRHRTVNNPIEDDSDRFEEFDVDSQMEPYVVEKTGATLKMSTAIALINRYCSKLPSDIFTRLVPHNQIIPIEENGVTKYCAELLLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHLEGELDDNLLPKGRESIAKLLEHIDEEPDEYAPGIAAKVGSSKRKQLYDKKIARALNESFVEADKECFIYAFELERFREAELTLNPKRRKFEDPFNYEYCFGFLSAKEIPKIPPFPVFLRQGNMKVRLIVAPKKTTVTAAQLQEIQLFHNYLFTQVLQMCKTGNLEFDGTSNAPLNTLIVPLNKRKDDMSYTINMKYVSEVVANMENMPRIPKDEVRRQYKFNAEDYKDAIVMPWYRNLEQPVFYYVAEILPEWRPSSKFPDTHFETFNEYFIKKYKLEIYDQNQSLLDVDFTSTRLNLLQPRIQNQPRRSRTVSNSSTSNIPQASASDSKESNTSVPHSSQRQILVPELMDIHPISATLWNVIAALPSIFYRVNQLLLTDELRETILVKAFGKEKTKLDDNVEWNSLAYATEYEEKQTIIVKKIQQLRDLNQKSIEDQERETRENDKIDDGEELFNIGVWDPEEAVRIGVEISSRDDRMDGEDQDTVGLTQGLHDGNISDEDDELPFVMHDYTARLTSNRNGIGAWSGSESIVPSGWGDWDGPEPDNSPMPFQILGGPGGLNVQALMADVGRVFDPSTASSSLSQTVQESTVSPPKQLTKEEEQFKKLQNDLLKQAKERLEALEMSEDMEKPRRLEDTVNLEDYGDDQENQEDENTPTNFPKTIDEEIEELSIGARKKQEIDDNAAKTDVLERENCEVLPVAINEKSRSFSFEKESKAINGRLIRQRSEEYVSHIDSDIGLGVSPCLLLTALTTSNAADGMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSFARSKEVSNCNLYRLGKKLGIPQLIVANKFDAHDSWLPPCYIPTCDFKAPNTDDAEEKDNEIERILDGQVIEEKPENKTGWDIGGDVSKSTTDGIETITFPKQARVGNDDISPLPYNLLTQQHISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSDVPSPLLRFIDTPTNPNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINNRVTGCYQRLEFLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCPGLYHMIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESVAGAIYLDSGRNLDTTWQVIFHMMRGTIELCCANPPRSPIRELMEFEQSKVRFSKMERILESGKVRVTVEVVNNMRFTGMGRNYRIAKATAAKRALKYLHQIEQQRRQSPSLTTV DIP protein P34529 original sequence version: 108 B49D19D7B3730F80 g5ebf5_caeel rde-4 T20G5.11 CELE_T20G5.11 protein protein caeel Caenorhabditis elegans MDLTKLTFESVFGGSDVPMKPSRSEDNKTPRNRTDLEMFLKKTPLMVLEEAAKAVYQKTPTWGTVELPEGFEMTLILNEITVKGQATSKKAARQKAAVEYLRKVVEKGKHEIFFIPGTTKEEALSNIDQISDKAEELKRSTSDAVQDNDNDDSIPTSAEFPPGISPTENWVGKLQEKSQKSKLQAPIYEDSKNERTERFLVICTMCNQKTRGIRSKKKDAKNLAAWLMWKALEDGIESLESYDMVDVIENLEEAEHLLEIQDQASKIKDKHSALIDILSDKKRFSDYSMDFNVLSVSTMGIHQVLLEISFRRLVSPDPDDLEMGAEHTQTEEIMKATAEKEKLRKKNMPDSGPLVFAGHGSSAEEAKQCACKSAIIHFNTYDFTD DIP protein G5EBF5 original sequence version: 2 017A9548CE9E0B2F g5edi8_caeel drh-1 CELE_F15B10.2 F15B10.2 protein protein caeel Caenorhabditis elegans MRKKQCSSILSLYDKEIILCLEPIYRDPEKGDGFSELLPLGRIDELKIQSENAQEFSKQLYHDLKNSILSNADDERLYKDIMTYLQTYLPKCTVHKLLNCSNREVKLSDFHYILDHFEGFLRFIEPKVVLAYLDSYPQYIDAVAVLRKEIERNEEDNQDSDFIKKLILRTVPLLGEQAVYDIMYTISEKSSNNLDVEAKQFIAKVLRLKNDGFLRFYQIINASRRQLNGRIYICPVHESATEMMVYLGTAALNTNRYRMINIRVDNIVQENSTPRLVIESVRQRIHRQRQLCLRNYQEELCQVALQGKNTIVTAPTGSGKTVIAANIIKEHFESRSSEGKRFKALFMTPNSMILNQQAASISSYLDHVYHTQIIQGSDNVPTRNVIQSKDLIVATPQMIVNLCNEHRNSLDDESRLDQFFLSTFTIIFFDECHNTVKNSPYSNIMREYHYLKNMGNMPEGHSLPQIIGLTASLGTGDKNDCLQVRNYIAGLCASMDVKDLSIVKDNLEELRGYSPIVPDKVLLCERSTDGPIGMFTNRLTLMMQEVEGLIRTALRNEHIGIEQRRQIETTERDFRPDSSFLDPPADKEHAGYQNWVCNQMNLVSGTSFRETGTRTIINEALDVLKECFCTLSYNINFHPEVALNYLKDEMEYRTPNFTVNMIRIWERYHNQLVGTGSAENPMISKTVQYIVEQNLQRADSRTIIFVRTRYEATILNKVLNSNEELLMLGIKSEWMSGLNKSTASSADISASKQKQMEKLKMFADGEIRILVSTSVAEEGLDVPECSLVIKYNYATNEIAHVQRRGRGRALNSECVLITNSIALRDQESNNRDKESLMSETISLIQNSPAEFRKCVDEESNKIWPRILREDTDKAQKIEEQINRNIVYKIICKKCEAILCTSKDIRSRNTQYLVCDPGFWSLVRKTRLTDEQQALIKYNATGSINCRRENCGLKLGQLIEVNTVDLPCLSALSIVLLVEGTDKRIIVKKWKNILDKYFTPTEIRQLDVQTMRDADQARTPMVFEHHANGEVVNLIREA DIP protein G5EDI8 original sequence version: 2 63D189175DDA6776 q9gzi7_caeel eri-3 CELE_W09B6.3 W09B6.3 protein protein caeel Caenorhabditis elegans MQPVLVNSRPLRVKSHESESKLNLIEQEDQFEGANYSSSSGVIICYSNGTGEVITQEAFDDSGIHFIFSKATCIQYPSNFDPIGVGSVVQIFWSRSFERVVRGNHIIVQIEKMEVYKCCAMLREQVFVTFNSPSTAGVAIGVTERNITVAFHPNCSPVIRYETLKAHSIGRTEFEIKDRHRENTNRMVDVILAAVPFRVEIHGNVDKIPFFVIEKCRNSPGRSGAAVITKIMKNHFMEANFLQNSESIYFDSTSCHSNILEKVSIGSLINVLADPTFATSSYKWYGYDVTLCNNYLAHASTQRSFVLENNEILQNCKKLEKSPEEAETTTKNDLRFVPPQPEKGEVKKKKMTNCLKFNSKSAQFKLRHLILDRCFSELPEREAKSIINSYFIDRLAEGIKIEKIDKNWRTFGEILPKTPKKYSESLKKSIQNVLEPFGLNKPEKAAETPKIVEYFPKNPKKRVEIVEKPTVDEIRELFGALMDAEGFALNQRVKPHFVLPDTRWKPTERRYIGIYDDVQWTFMSTFCPKIEENSENRPLAGGWWYRRTVPRDHPVEIVQKMETRRNIIKDCTESPFIE DIP protein Q9GZI7 original sequence version: 52 154C1830BE316596 g5eeh0_caeel rde-1 CELE_K08H10.7 K08H10.7 protein protein caeel Caenorhabditis elegans MSSNFPELEKGFYRHSLDPEMKWLARPTGKCDGKFYEKKVLLLVNWFKFSSKIYDREYYEYEVKMTKEVLNRKPGKPFPKKTEIPIPDRAKLFWQHLRHEKKQTDFILEDYVFDEKDTVYSVCRLNTVTSKMLVSEKVVKKDSEKKDEKDLEKKILYTMILTYRKKFHLNFSRENPEKDEEANRSYKFLKNVMTQKVRYAPFVNEEIKVQFAKNFVYDNNSILRVPESFHDPNRFEQSLEVAPRIEAWFGIYIGIKELFDGEPVLNFAIVDKLFYNAPKMSLLDYLLLIVDPQSCNDDVRKDLKTKLMAGKMTIRQAARPRIRQLLENLKLKCAEVWDNEMSRLTERHLTFLDLCEENSLVYKVTGKSDRGRNAKKYDTTLFKIYEENKKFIEFPHLPLVKVKSGAKEYAVPMEHLEVHEKPQRYKNRIDLVMQDKFLKRATRKPHDYKENTLKMLKELDFSSEELNFVERFGLCSKLQMIECPGKVLKEPMLVNSVNEQIKMTPVIRGFQEKQLNVVPEKELCCAVFVVNETAGNPCLEENDVVKFYTELIGGCKFRGIRIGANENRGAQSIMYDATKNEYAFYKNCTLNTGIGRFEIAATEAKNMFERLPDKEQKVLMFIIISKRQLNAYGFVKHYCDHTIGVANQHITSETVTKALASLRHEKGSKRIFYQIALKINAKLGGINQELDWSEIAEISPEEKERRKTMPLTMYVGIDVTHPTSYSGIDYSIAAVVASINPGGTIYRNMIVTQEECRPGERAVAHGRERTDILEAKFVKLLREFAENNDNRAPAHIVVYRDGVSDSEMLRVSHDELRSLKSEVKQFMSERDGEDPEPKYTFIVIQKRHNTRLLRRMEKDKPVVNKDLTPAETDVAVAAVKQWEEDMKESKETGIVNPSSGTTVDKLIVSKYKFDFFLASHHGVLGTSRPGHYTVMYDDKGMSQDEVYKMTYGLAFLSARCRKPISLPVPVHYAHLSCEKAKELYRTYKEHYIGDYAQPRTRHEMEHFLQTNVKYPGMSFA DIP protein G5EEH0 original sequence version: 2 8E2F1A2EFC43A670 g5ebq3_caeel RNA-directed RNA polymerase ego-1 CELE_F26A3.3 F26A3.3 protein protein caeel Caenorhabditis elegans MGDEGYRGWIKLEIPCSLPERQMGPIVKCHVAKLEPALNEYNIKVLTKGQVQVVEEQDCEPFYETNYEVATSRFSHDLIAAIQTYLKDLSTDHLMPFQRGNLVLHSSDFWSSELTCHLVDIPLAAVFFGNIQGGTFINHWEVSFWDDVRRRKSARTRNTEPTQADKIGMNQIKVEFEFDKIDFMTVHFKHFENDFEVADKDAKRTKQTVTMYYQITVRRTSIRRIIVDPVVQDCNGSDRIRVHFELNCPVLIRRAYRTAKQESENRHSVPHYRRYLVINRGRSANQYPTAKAITDSPVFTIEFDQSVGLNEIYRLLSRLRIRTGVSIEFADIPSIDCLIWRENPYNRWTFLNNQHLSPTHFSAPIYRDFITTAFPKKHEVCGSREVDTNRERKFAITYLLECLISRGAVVKDQILLDEGIWHRFLEVILHYYTKDDKLCEAGLEDLVHMIDGRKRIGSLIKCFDRICQTRQRNSLVNGLTTEEMREGYQRVRKIIFTPTRVIYVAPETLMGNRVLRRYDHDGTRVLRITFRDDDNQKMRTNKTSTMLEKTVNQYLKNGITVAGRNFGYLGSSNSQMRDNGAYFMEKYSSSQCREYERIYQIKPPITFNPKIQAARKNLGRFETIDNIPKMMARLGQCFTQSRLSGVNLERCTYMTTYDLTGGKNLKGDEYTFSDGVGMMSYRFAQMVSEVMDFGKGVPSCFQFRFRGMKGVISIEPLLDNLRQWSISYNISKPSDDSSWSLNCMFRPSQIKFISKRHPRDQVEIVKYSSPVPVALNKPFINILDQVSEMQSLECHRRVTNRIEELLDRQMLSFAQQMVDETFCRNRLKELPRRVDIDYLRTTWGFTLSSEPFFRSLIKASIKFSITRQLRKEQIPIPCDLGRSMLGVVDETGRLQYGQIFVQYTKNLALKLPPKNAARQVLTGTVLLTKNPCIVAGDVRIFEAVDIPELHHMCDVVVFPQHGPRPHPDEMAGSDLDGDEYSIIWDQQLLLDKNEDPYDFTSEKQKASFKEDEIDDLMREFYVKYLKLDSVGQISNSHLHNSDQYGLNARVCMDLAKKNCQAVDFTKSGQPPDELERKWRKDEETGEMIPPERAERVPDYHMGNDHTPMYVSPRLCGKLFREFKAIDDVLKISEERDEQVEISIDETIKIDGYTEYMASAKNDLARYNAQLRSMMENYGIKTEGEVFSGCIVDMRNRISDKDQDDMSFFNTNQMIETKLTNLFKKYREIFFEEFEGGWEGNTEAFSRYGRDSNILQRQCRAPTVQMMKKAVAWYRACYEEARITRENKKLSFAWLAYDVIAKVKQDKSLTSDEVKMGGANPLYTMLDDHRSQYLVDNSRKFEAFRQFSTPKTSGEQVKRAHRIIKMYTETYPGLDAVLFMLDEWARISNLFENQSLREYHLSLLFILFATRQFSSVDGNAAKFFNKVDEKSYKQSKTIGDFEPSLYIEEKGKSQMMVKFLEFLASRKFRKMANLSFCALDFSSIFMRGEWQIFHLAALKTYYNVLFNLRFEELPVSTDPTTTVRSIIRENEPFVIELPANCDRSLVHRKLVEHTGVKEIFMRNMEKSVRSSDDVQKINMRLLVSTRGTLESMYKLRQLVAVKVPIKTYVTGQDVSTQMARLCYEKIVRGHINI DIP protein G5EBQ3 original sequence version: 2 0DFF23D5FF245A3C dcr_1-drh_1-1 23 33 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 32 unspecified role unspecified role bait bait caeel Caenorhabditis elegans 34 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association eri_5-dcr_1-1 14 29 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 28 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 35 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 33 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 32 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 30 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 27 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 25 unspecified role unspecified role bait bait caeel Caenorhabditis elegans association association dcr_1-eri_3-1 13 35 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 32 unspecified role unspecified role bait bait Region 220-427 Region 220-427 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 272-1045 Region 272-1045 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction rrf_3-ekl_1-1 15 26 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 27 unspecified role unspecified role bait bait caeel Caenorhabditis elegans physical association physical association dcr_1-drh_1-2 11 34 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans 33 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans 32 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans physical association physical association rde_4-dcr_1-1 5 36 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range caeel Caenorhabditis elegans 33 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range caeel Caenorhabditis elegans 32 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 34 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association rde_1-dcr_1-1 18 36 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range caeel Caenorhabditis elegans 33 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range caeel Caenorhabditis elegans 32 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 34 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association drh_1-dcr_1-1 21 36 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 33 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 32 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 34 unspecified role unspecified role bait bait caeel Caenorhabditis elegans association association eri_5-rrf_3-1 9 25 unspecified role unspecified role bait bait caeel Caenorhabditis elegans 27 unspecified role unspecified role prey prey caeel Caenorhabditis elegans physical association physical association dcr_1-drh_3-1 22 30 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 25 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 32 unspecified role unspecified role bait bait caeel Caenorhabditis elegans 27 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association rde_4-rde_1-1 3 36 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 33 unspecified role unspecified role bait bait caeel Caenorhabditis elegans physical association physical association rde_4-dcr_1-2 16 36 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 33 unspecified role unspecified role bait bait caeel Caenorhabditis elegans 32 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 34 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association rde_4-dcr_1-3 2 33 unspecified role unspecified role bait bait caeel Caenorhabditis elegans 32 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 34 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association drh_1-dcr_1-2 17 32 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 34 unspecified role unspecified role bait bait caeel Caenorhabditis elegans physical association physical association eri_5-dcr_1-2 19 30 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 25 unspecified role unspecified role bait bait caeel Caenorhabditis elegans 32 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 27 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association dcr_1-eri_3-2 7 25 unspecified role unspecified role prey prey CBP-tag CBP-tag cam tag calmodulin binding protein tag cam tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 35 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 32 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 272-1045 Region 272-1045 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association eri_5-drh_3-1 1 30 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 25 unspecified role unspecified role bait bait caeel Caenorhabditis elegans physical association physical association ekl_1-ego_1-1 8 37 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 26 unspecified role unspecified role bait bait caeel Caenorhabditis elegans physical association physical association drh_1-dcr_1-3 20 33 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 32 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 34 unspecified role unspecified role bait bait caeel Caenorhabditis elegans association association dcr_1-eri_5-1 6 25 unspecified role unspecified role prey prey CBP-tag CBP-tag cam tag calmodulin binding protein tag cam tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 32 unspecified role unspecified role bait bait Region 220-427 Region 220-427 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 272-1045 Region 272-1045 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction dcr_1-drh_3-2 10 30 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans 31 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans 25 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans 27 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans 33 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans 32 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans physical association physical association dcr_1-drh_1-3 12 36 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 33 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 32 unspecified role unspecified role bait bait caeel Caenorhabditis elegans 34 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association dcr_1-drh_1-4 24 32 unspecified role unspecified role bait bait caeel Caenorhabditis elegans 34 unspecified role unspecified role prey prey caeel Caenorhabditis elegans physical association physical association rrf_3-dcr_1-1 4 26 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 25 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 32 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 27 unspecified role unspecified role bait bait caeel Caenorhabditis elegans association association