UniProt UniProt http://www.uniprot.org Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity. Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity. PloS one 2010 imex curation Pereira LA., Wong MS., Lim SM., Sides A., Stanley EG., Elefanty AG. ed.stanley@monash.edu Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Pereira LA., Wong MS., Lim SM., Sides A., Stanley EG., Elefanty AG. ed.stanley@monash.edu Accepted 2017-FEB-06 AT 11:12 GMT AT 11:12 GMT by MGT PloS one 2010 imex curation Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity. Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity. PloS one 2010 imex curation Pereira LA., Wong MS., Lim SM., Sides A., Stanley EG., Elefanty AG. ed.stanley@monash.edu Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pereira LA., Wong MS., Lim SM., Sides A., Stanley EG., Elefanty AG. ed.stanley@monash.edu Accepted 2017-FEB-06 AT 11:12 GMT AT 11:12 GMT by MGT PloS one 2010 imex curation Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity. Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity. PloS one 2010 imex curation Pereira LA., Wong MS., Lim SM., Sides A., Stanley EG., Elefanty AG. ed.stanley@monash.edu Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pereira LA., Wong MS., Lim SM., Sides A., Stanley EG., Elefanty AG. Day 4 ESC-derived embryoid bodies (three-dimensional aggregates of pluripotent stem cells) have been used. ed.stanley@monash.edu Accepted 2017-FEB-06 AT 11:12 GMT AT 11:12 GMT by MGT PloS one 2010 imex curation Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity. Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity. PloS one 2010 imex curation Pereira LA., Wong MS., Lim SM., Sides A., Stanley EG., Elefanty AG. ed.stanley@monash.edu Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Pereira LA., Wong MS., Lim SM., Sides A., Stanley EG., Elefanty AG. ed.stanley@monash.edu Accepted 2017-FEB-06 AT 11:12 GMT AT 11:12 GMT by MGT PloS one 2010 imex curation Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity. Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity. PloS one 2010 imex curation Pereira LA., Wong MS., Lim SM., Sides A., Stanley EG., Elefanty AG. ed.stanley@monash.edu Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Pereira LA., Wong MS., Lim SM., Sides A., Stanley EG., Elefanty AG. ed.stanley@monash.edu Accepted 2017-FEB-06 AT 11:12 GMT AT 11:12 GMT by MGT PloS one 2010 imex curation eomes_mouse Eomesodermin homolog T-box brain protein 2 Eomes Tbr2 protein protein mouse Mus musculus Mouse MQLGEQLLVSSVNLPGAHFYSLESARGGGGGGGGGGGGGGGSVSLLPGAAPSPQRLDLDKASKKFPGSLPCQAGSAEPAGAGAGAPAAMLSDADAGDTFGSTSAVAKPGPPDGRKGSPCAEEELPSAATAAATARYSMDSLSSERYYLPSPGPQGSELAAPCSLFQYPAAAGAAHGPVYPASNGARYPYGSMLPPGGFPAAVCPPARAQFGPAAGSGSGAGSSGGGAGGPGAYPYGQGSPLYGPYAGTSAAGSCGGLGGLGVPGSGFRAHVYLCNRPLWLKFHRHQTEMIITKQGRRMFPFLSFNINGLNPTAHYNVFVEVVLADPNHWRFQGGKWVTCGKADNNMQGNKMYVHPESPNTGSHWMRQEISFGKLKLTNNKGANNNNTQMIVLQSLHKYQPRLHIVEVTEDGVEDLNEPSKTQTFTFSETQFIAVTAYQNTDITQLKIDHNPFAKGFRDNYDSMYTASENDRLTPSPTDSPRSHQIVPGGRYGVQNFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPVTNKLDIGSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGAYQRKMAAGLPWTSRMSPPVFPEDQLAKEKVKEEISSSWIETPPSIKSLDSSDSGVYNSACKRKRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAYYAFYTSP 277AA462E214A927 tbxt_xenla T-box transcription factor T tbxt Brachyury protein Protein T bra t protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSATESCAKNVQYRVDHLLSAVENELQAGSEKGDPTEKELKVSLEERDLWTRFKELTNEMIVTKNGRRMFPVLKVSMSGLDPNAMYTVLLDFVAADNHRWKYVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKDPVSFSKVKLTNKMNGGGQIMLNSLHKYEPRIHIVRVGGTQRMITSHSFPETQFIAVTAYQNEEITALKIKHNPFAKAFLDAKERNDYKDILDEGIDSQHSNFSQLGTWLIPNGGSLCSPNPHTQFGAPLSLSSPHGCERYSSLRNHRSAPYPSPYTHRNNSPNNLADNSSACLSMLQSHDNWSTLQMPAHTGMLPMSHSTGTPPPSSQYPSLWSVSNSAITPVSQSGGITNGISSQYLLGSTPHYSSLSHAVPSPSTGSPLYEHGAQTEIAENQYDVTAHSRLSSTWTPVAPPSV 2F91D942D86EE60A tbx6_mouse T-box transcription factor TBX6 Tbx6 protein protein mouse Mus musculus Mouse MYHPRELYPSLGTGYRLGHPQPGADSTFPPALTEGYRYPDLDTSKLDCFLSGIEAAPHTLAAAAPLPLLPSALGPETAPPPPEALHSLPGVSLSLENQELWKEFSAVGTEMIITKAGRRMFPACRVSVTGLDPEARYLFLLDVVPVDGARYRWQGQHWEPSGKAEPRLPDRVYIHPDSPATGAHWMRQPVSFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRATQLCSQHWGGVASFRFPETTFISVTAYQNPRITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPVATEACGSGDTPGGPCDSTLGGDIRDSDPEQAPTPQEAASASAPPCGGPSAEAYLLHPAAFHGAPSHLPARTPSFAEAPDPGRPAPYSAAFLDLQPGPGGSAYQAAPSVPSFAPHFIQGGPFPLPYPGPGGYLDMGSKPMY DBAAD94C88E9CC4B tbx3_mouse T-box transcription factor TBX3 Tbx3 protein protein mouse Mus musculus Mouse MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGALAKPIMDQLVGAAETGIPFSSLGPQAHLRPLKTMEPEEDVEDDPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQTILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLTLQSMRVFEERHKKETSDESSSEQAAFNCFAQASSPAVSIVGTSNLKDLCPSEAESDAEAESKEEHGPEACDAAKISTTTAEEPGRDKGSPATRAQLFPAEPSRARDTARLDKASPDSRHSPATISSSTRVPGADERRSPGREGPVATKVDEARAIPAKDAFAPLSVQTDATAHLAQGPLPGLGFAPGLAGQQFFNGHPLFLHPGQFAMGGAFSSMAAGMGPLLATVSGASTGVSGLESTAMASAAAAQGLSGASAATLPFHLQQHVLASQGLAMSPFGSLFPYPYTYMAAAAAASTAAASSSVHRHPFLNLNSMRPRLRYSPYSIPVPVPDSSSLLATALPSMASAAGPLDGKAAALAASPASVAVDSGSELNSRSSTLSSGSVSLSPKLCSEKEAATSELQSIQRLVSGLEAKPDRSCSGSP B502FE817EFF124D gsc_mouse Homeobox protein goosecoid Gsc protein protein mouse Mus musculus Mouse MPASMFSIDNILAARPRCKDAVLPVAPSAAAPVVFPALHGDSLYGAGGGTSSDYGAFYPRPVAPGGAGLPAAVGSSRLGYNSYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSKASPEKREEEGKSDLDSDS mint Goosecoid-expressing regions of the gastrulating mouse egg cylinder have organizer-like activity when transplanted into Xenopus embryos 3639FB059AC3DB9E mixl1_human Homeobox protein MIXL1 Homeodomain protein MIX MIX1 homeobox-like protein 1 Mix.1 homeobox-like protein MIXL1 MIXL protein protein human Homo sapiens Human MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPATFAGFLGRDPGPAPPPPASLGSPAPPKGAAAPSASQRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF 2E8A6A811799A8F0 tbx20_mouse T-box transcription factor TBX20 Tbx20 Tbx12 protein protein mouse Mus musculus Mouse MEFTASPKPQLSSRANAFSIAALMSSGGPKEKEAAENTIKPLEQFVEKSSCAQPLGELTSLDAHAEFGGGGGSPSSSSLCTEPLIPTTPIIPSEEMAKIACSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVDPESKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKDHTASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERESVESLIQKHSYARSPIRTYGEEDVLGEESQTTQSRGSAFTTSDNLSLSSWVSSSSSFPGFQHPQPLTALGTSTASIATPIPHPIQGSLPPYSRLGMPLTPSAIASSMQGSGPTFPSFHMPRYHHYFQQGPYAAIQGLRHSSAVMTPFV 4EAEED0DF0329E57 mix1_xenla Homeobox protein Mix.1 mix-a mix1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MDGFSQQLEDLYPSCFSPCPSPLGFSEPVIQPFAMNLAPAAQKDFQQHPNRREVTKIPGAGEQSPVQNVRPKDAINPKEADPRSPTADASLVPASQRRKRTFFTQAQLDILEQFFQTNMYPDIHHREELARHIYIPESRIQVWFQNRRAKVRRQGAKATKPILAGHHYSGTSGANRAMFPSAPAPNSSSHQMTTSRAQVQPLKESQMNMFHQNQGFLPYPDSSCNVSRQRFLMSQPTPGAYHLPQASSNVYNQNVKSQNPLWNQQTTNRVYTNMMETVLDLSRRPSQQMPVQPMLMNSFQTNKNIKPEVYTTSPQIPVSTTSSQVSLFANQEPCHMSTTQGGTYGQISPISDSGVSDTSPEPSSDWEENVASVLLNL 6BA404359B57D221 tbxt_mouse T-box transcription factor T Tbxt Brachyury protein Protein T T protein protein mouse Mus musculus Mouse MSSPGTESAGKSLQYRVDHLLSAVESELQAGSEKGDPTERELRVGLEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVTADNHRWKYVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQRMITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNDHKDVMEEPGDCQQPGYSQWGWLVPGAGTLCPPASSHPQFGGSLSLPSTHGCERYPALRNHRSSPYPSPYAHRNSSPTYADNSSACLSMLQSHDNWSSLGVPGHTSMLPVSHNASPPTGSSQYPSLWSVSNGTITPGSQTAGVSNGLGAQFFRGSPAHYTPLTHTVSAATSSSSGSPMYEGAATVTDISDSQYDTAQSLLIASWTPVSPPSM DIP protein P20293 original sequence version: 126 1A0BDF9BA7FC2484 mixl1_mouse Homeobox protein MIXL1 Homeodomain protein MIX MIX1 homeobox-like protein 1 Mix.1 homeobox-like protein Mixl1 Mix Mml protein protein mouse Mus musculus Mouse MAAAGSQQLQFAEGAAFPIFPAAHPGGQLLPAMRPASGLPAAPHDSRAPAATQCFPNRDSSPTAQTPAGLDPPGPSKGSAAPSAPQRRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLSSRRGVFLHCPAPGTEARCLKPQLPLEADVNHVPDPSMTGGGVCTSGSQSFETYSSLSEDIGSKLDSWEEHIFSALGNF 59DA80A5E7E6EE33 tbxt_human T-box transcription factor T TBXT Brachyury protein Protein T T protein protein human Homo sapiens Human MSSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRVGLEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQRMITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYPSLWSVSNGAVTPGSQAAAVSNGLGAQFFRGSPAHYTPLTHPVSAPSSSGSPLYEGAAAATDIVDSQYDAAAQGRLIASWTPVSPPSM 9D470088C8602631 mixl1-t-1 2 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1B mixl1-t-2 5 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C mixl1-mixl1-1 2 15 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S2 mixl1-1 2 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S2 t-mixl1-1 4 14 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection Q9WUI0:p.Pro126Ile mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P I Wed May 02 16:22:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro126ile' Tue Jun 30 20:22:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro126Ile' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9WUI0:p.Val132Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V A Wed May 02 17:22:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val132ala' Tue Jun 30 17:39:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val132Ala' Q9WUI0:p.Ile113Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I R Wed May 02 14:54:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile113arg' Tue Jun 30 18:22:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile113Arg' Q9WUI0:p.Arg143Ile mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R I Wed May 02 15:47:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg143ile' Tue Jun 30 19:16:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg143Ile' mutant constructs val132ala, ile113arg and arg143ile interact with similar strength physical association physical association 2B, 3A, 4D, S4A and B tbx3-mixl1-1 4 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S4A tbx6-mixl1-1 4 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4D, S4A, tbx20-mixl1-1 4 12 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S4A t-mixl1-2 1 15 unspecified role unspecified role prey prey cell lysate cell lysate mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells Nuclear protein extracts of day 4 ESC-derived embryoid bodies habe been used 14 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 1C mixl1-t-3 1 15 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range homeobox_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined p53-like_tf_dna-bd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 73 70 physical association physical association 1E, 2 E mixl1-t-4 1 16 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 1E mix_a-t-1 1 13 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 1E mixl1-t-5 3 14 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association 1D t-mixl1-3 4 14 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2D mixl1-6 4 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9WUI0:p.Pro126Ile mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P I Wed May 02 20:16:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro126ile' Tue Jun 30 18:03:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro126Ile' Q9WUI0:p.Val132Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V A Wed May 02 15:02:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val132ala' Tue Jun 30 20:24:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val132Ala' Q9WUI0:p.Ile113Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I R Wed May 02 20:11:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile113arg' Tue Jun 30 18:57:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile113Arg' Q9WUI0:p.Arg143Ile mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R I Wed May 02 19:07:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg143ile' Tue Jun 30 20:05:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg143Ile' mutant constructs val132ala, ile113arg and arg143ile interact with similar strength physical association physical association 3B mixl1-7 4 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4D t-gsc-1 4 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 4E tbx3-gsc-1 4 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 4E tbx6-gsc-1 4 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 4E tbx20-gsc-1 4 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 4E