DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural insights into the autoactivation mechanism of p21-activated protein kinase. Structural insights into the autoactivation mechanism of p21-activated protein kinase. Structure (London, England : 1993) 2011 imex curation Wang J., Wu JW., Wang ZX. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Wang J., Wu JW., Wang ZX. DIP original experiment: DIP-220146X Structure (London, England : 1993) 2011 IMEx Structural insights into the autoactivation mechanism of p21-activated protein kinase. Structural insights into the autoactivation mechanism of p21-activated protein kinase. Structural insights into the autoactivation mechanism of p21-activated protein kinase. Structure (London, England : 1993) 2011 imex curation Wang J., Wu JW., Wang ZX. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Wang J., Wu JW., Wang ZX. DIP original experiment: DIP-220145X Structure (London, England : 1993) 2011 IMEx Structural insights into the autoactivation mechanism of p21-activated protein kinase. Structural insights into the autoactivation mechanism of p21-activated protein kinase. Structural insights into the autoactivation mechanism of p21-activated protein kinase. Structure (London, England : 1993) 2011 imex curation Wang J., Wu JW., Wang ZX. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang J., Wu JW., Wang ZX. DIP original experiment: DIP-220144X Structure (London, England : 1993) 2011 IMEx Structural insights into the autoactivation mechanism of p21-activated protein kinase. paktide Pak1 substrate peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) TPEQSKRSTMVGTPY pak1_rat Serine/threonine-protein kinase PAK 1 p21-activated kinase 1 p68-PAK Alpha-PAK Protein kinase MUK2 Pak1 protein protein rat Rattus norvegicus (Rat) Rat MSNNGLDVQDKPPAPPMRNTSTMIGAGSKDPGTLNHGSKPLPPNPEEKKKKDRFYRSILAGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH DIP protein P35465 original sequence version: 113 DIP protein P35465 original sequence version: 125 93BE32D8222F5B7B q13153-1 Serine/threonine-protein kinase PAK 1 PAK1 Alpha-PAK p21-activated kinase 1 p65-PAK protein protein human Homo sapiens Human MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH DIP protein Q13153-1 original sequence version: 161 DIP protein Q13153-1 original sequence version: 135 pak1-6 3 6 unspecified role unspecified role unspecified role unspecified role Kinase domain Region 249-545 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q13153-1:p.Asp389Asn D389N mutation increasing mutation increasing interaction mutation increasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D389N'. Wed May 02 20:03:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp389asn' Tue Jun 30 19:27:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp389Asn' ecolx Escherichia coli direct interaction direct interaction pak1-paktide-1 2 4 enzyme target enzyme target substrate substrate unspecified role unspecified role in vitro In vitro 6 enzyme enzyme unspecified role unspecified role Kinase domain Region 249-545 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation pak1-paktide-2 1 5 enzyme enzyme unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 4 enzyme target enzyme target substrate substrate unspecified role unspecified role in vitro In vitro phosphorylation phosphorylation reaction phosphorylation