DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Multiple molecular architectures of the eye lens chaperone αB-crystallin elucidated by a triple hybrid approach. Multiple molecular architectures of the eye lens chaperone αB-crystallin elucidated by a triple hybrid approach. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Braun N., Zacharias M., Peschek J., Kastenmüller A., Zou J., Hanzlik M., Haslbeck M., Rappsilber J., Buchner J., Weinkauf S. Only protein-protein interactions ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Braun N., Zacharias M., Peschek J., Kastenmüller A., Zou J., Hanzlik M., Haslbeck M., Rappsilber J., Buchner J., Weinkauf S. DIP original experiment: DIP-250147X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Multiple molecular architectures of the eye lens chaperone αB-crystallin elucidated by a triple hybrid approach. Multiple molecular architectures of the eye lens chaperone αB-crystallin elucidated by a triple hybrid approach. Multiple molecular architectures of the eye lens chaperone αB-crystallin elucidated by a triple hybrid approach. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Braun N., Zacharias M., Peschek J., Kastenmüller A., Zou J., Hanzlik M., Haslbeck M., Rappsilber J., Buchner J., Weinkauf S. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Braun N., Zacharias M., Peschek J., Kastenmüller A., Zou J., Hanzlik M., Haslbeck M., Rappsilber J., Buchner J., Weinkauf S. DIP original experiment: DIP-250149X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Multiple molecular architectures of the eye lens chaperone αB-crystallin elucidated by a triple hybrid approach. Multiple molecular architectures of the eye lens chaperone αB-crystallin elucidated by a triple hybrid approach. Multiple molecular architectures of the eye lens chaperone αB-crystallin elucidated by a triple hybrid approach. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Braun N., Zacharias M., Peschek J., Kastenmüller A., Zou J., Hanzlik M., Haslbeck M., Rappsilber J., Buchner J., Weinkauf S. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Braun N., Zacharias M., Peschek J., Kastenmüller A., Zou J., Hanzlik M., Haslbeck M., Rappsilber J., Buchner J., Weinkauf S. DIP original experiment: DIP-250148X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Multiple molecular architectures of the eye lens chaperone αB-crystallin elucidated by a triple hybrid approach. Multiple molecular architectures of the eye lens chaperone αB-crystallin elucidated by a triple hybrid approach. Multiple molecular architectures of the eye lens chaperone αB-crystallin elucidated by a triple hybrid approach. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Braun N., Zacharias M., Peschek J., Kastenmüller A., Zou J., Hanzlik M., Haslbeck M., Rappsilber J., Buchner J., Weinkauf S. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Braun N., Zacharias M., Peschek J., Kastenmüller A., Zou J., Hanzlik M., Haslbeck M., Rappsilber J., Buchner J., Weinkauf S. DIP original experiment: DIP-250150X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Multiple molecular architectures of the eye lens chaperone αB-crystallin elucidated by a triple hybrid approach. cryab_human Alpha-crystallin B chain CRYAB CRYA2 Renal carcinoma antigen NY-REN-27 Alpha(B)-crystallin Rosenthal fiber component Heat shock protein beta-5 HSPB5 protein protein human Homo sapiens Human MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK DIP protein P02511 original sequence version: null AE08BED46B7849CB DIP protein P02511 original sequence version: 195 DIP protein P02511 original sequence version: 130 DIP protein P02511 original sequence version: 131 DIP protein P02511 original sequence version: 151 DIP protein P02511 original sequence version: 167 DIP protein P02511 original sequence version: 154 DIP protein P02511 original sequence version: 146 AE08BED46B7849CB cryab-16 1 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cryab-17 3 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cryab-18 2 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cryab-19 4 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction