DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Arabidopsis cryptochrome 2 (CRY2) functions by the photoactivation mechanism distinct from the tryptophan (trp) triad-dependent photoreduction. Arabidopsis cryptochrome 2 (CRY2) functions by the photoactivation mechanism distinct from the tryptophan (trp) triad-dependent photoreduction. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Li X., Wang Q., Yu X., Liu H., Yang H., Zhao C., Liu X., Tan C., Klejnot J., Zhong D., Lin C. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li X., Wang Q., Yu X., Liu H., Yang H., Zhao C., Liu X., Tan C., Klejnot J., Zhong D., Lin C. DIP original experiment: DIP-253810X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Arabidopsis cryptochrome 2 (CRY2) functions by the photoactivation mechanism distinct from the tryptophan (trp) triad-dependent photoreduction. Arabidopsis cryptochrome 2 (CRY2) functions by the photoactivation mechanism distinct from the tryptophan (trp) triad-dependent photoreduction. Arabidopsis cryptochrome 2 (CRY2) functions by the photoactivation mechanism distinct from the tryptophan (trp) triad-dependent photoreduction. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Li X., Wang Q., Yu X., Liu H., Yang H., Zhao C., Liu X., Tan C., Klejnot J., Zhong D., Lin C. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li X., Wang Q., Yu X., Liu H., Yang H., Zhao C., Liu X., Tan C., Klejnot J., Zhong D., Lin C. DIP original experiment: DIP-253811X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Arabidopsis cryptochrome 2 (CRY2) functions by the photoactivation mechanism distinct from the tryptophan (trp) triad-dependent photoreduction. Arabidopsis cryptochrome 2 (CRY2) functions by the photoactivation mechanism distinct from the tryptophan (trp) triad-dependent photoreduction. Arabidopsis cryptochrome 2 (CRY2) functions by the photoactivation mechanism distinct from the tryptophan (trp) triad-dependent photoreduction. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Li X., Wang Q., Yu X., Liu H., Yang H., Zhao C., Liu X., Tan C., Klejnot J., Zhong D., Lin C. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Li X., Wang Q., Yu X., Liu H., Yang H., Zhao C., Liu X., Tan C., Klejnot J., Zhong D., Lin C. DIP original experiment: DIP-253812X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Arabidopsis cryptochrome 2 (CRY2) functions by the photoactivation mechanism distinct from the tryptophan (trp) triad-dependent photoreduction. bh063_arath Transcription factor bHLH63 BHLH63 EN84 Basic helix-loop-helix protein 63 Transcription factor EN 84 bHLH transcription factor bHLH063 T4L20.110 At4g34530 CIB1 Protein CRYPTOCHROME INTERACTING BASIC-HELIX-LOOP-HELIX 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNGAIGGDLLLNFPDMSVLERQRAHLKYLNPTFDSPLAGFFADSSMITGGEMDSYLSTAGLNLPMMYGETTVEGDSRLSISPETTLGTGNFKKRKFDTETKDCNEKKKKMTMNRDDLVEEGEEEKSKITEQNNGSTKSIKKMKHKAKKEENNFSNDSSKVTKELEKTDYIHVRARRGQATDSHSIAERVRREKISERMKFLQDLVPGCDKITGKAGMLDEIINYVQSLQRQIEFLSMKLAIVNPRPDFDMDDIFAKEVASTPMTVVPSPEMVLSGYSHEMVHSGYSSEMVNSGYLHVNPMQQVNTSSDPLSCFNNGEAPSMWDSHVQNLYGNLGV DIP protein Q8GY61 original sequence version: 62 DIP protein Q8GY61 original sequence version: 71 05F0CA14FC2B3C7A spa1_arath Protein SUPPRESSOR OF PHYA-105 1 SPA1 F11C10.3/F11C10.4 At2g46340/At2g46350 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPVMERVAEETVATNNIQLKARVDDVPCNKLDARHNDMVIQSETANSDCPGSSAHRNVDLTKPPPPEEAAGAKLSVEELTLGNYRIVQGSNNTNVDSPRAGKFEHLYRLARGSAFRAGDGDLDSQPRDMDQMLSRIRQQLAGAPSERQNLKPFMSRRSDQNLEAFSERLRAAGENSIMNAPALISEGVQMKTPVSSSNFSQLLLKRAMKGKGVVGKNQETPPEFVSDQDLGSKEKKLDISKSPTPHDVLPLKSSPKGNGMVSHGDGNHSKSSIGISLREFLRSSYAKREKRHGLCLFRQLVELVDSAHSKRLFLLDLRPSLFTLVPSKKLRYIGNFGKNDLESDVDEDLNRRRPVVEESSSGGRDSKKRKMDLHLNSPGNQLQATSTGRPFKRKSPVIDLNMVDARNPDSCELQQQDYIKNLSVSSVSRKQSMSTWLEEQWYTCPEEINGEDIGEKSNIYALGVLLFELLCHCESGEMHAAMMADLRHRILPPTFLSKYPKEAGFCLWLLHPEPSSRPSARDILKSELICEDDSVKSTAAAEEISELLLHFLSSLEVQKKKKASKLLQDIQTLEDDIKEAERRYSSNVSLVRSHGAIEKRVQSSPLDEHCTTSSALFVPTANTDRLMSNIRQLEDAYFFMRSQINLSSSAATARSDKTLKDRDRCSENQNENQDMSTKGKSSDQLEVFFEGLCKFARYSKFETCGTIRSGDLLNSASVVCSLSFDPDEEHIAAAGISKKIKIFDFNAFMNESVGVHYPLVEMVNKSKLSCVCWNSYIKNYLASTDYDGVVQIWDAGTGQGFSQYTEHQKRAWSVDFSPSDPTKFVSGSDDCSVKLWSINEKRSLGTIWSPANVCCVQFSSYSNHLLAFGSADYKVYCYDLRYVKTPWCTLAGHEKAVSYVKFMDSETIVSASTDNSLKLWNLNKTNSSGLSPGACSLTYKGHTNQKNFVGLSVLDGYIACGSETNEVYSYYKSLPMPMTSYKFGSVDPISGNEYFDDNGQFVSSVCWRKKSNMLVAANSTGNMKLLKLV DIP protein Q9SYX2 original sequence version: 102 8DEDF32BB06B4A18 cry2_arath Cryptochrome-2 Blue light photoreceptor CRY2 PHH1 Protein PHR homolog 1 Protein SUPPRESSOR OF elf3 20 SEL20 F19P19.14 At1g04400 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKMDKKTIVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSLKALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQSYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSIESVMLPPPWRLMPITAAAEAIWACSIEELGLENEAEKPSNALLTRAWSPGWSNADKLLNEFIEKQLIDYAKNSKKVVGNSTSLLSPYLHFGEISVRHVFQCARMKQIIWARDKNSEGEESADLFLRGIGLREYSRYICFNFPFTHEQSLLSHLRFFPWDADVDKFKAWRQGRTGYPLVDAGMRELWATGWMHNRIRVIVSSFAVKFLLLPWKWGMKYFWDTLLDADLECDILGWQYISGSIPDGHELDRLDNPALQGAKYDPEGEYIRQWLPELARLPTEWIHHPWDAPLTVLKASGVELGTNYAKPIVDIDTARELLAKAISRTREAQIMIGAAPDEIVADSFEALGANTIKEPGLCPSVSSNDQQVPSAVRYNGSKRVKPEEEEERDMKKSRGFDERELFSTAESSSSSSVFFVSQSCSLASEGKNLEGIQDSSDQITTSLGKNGCK DIP protein Q96524 original sequence version: 123 DIP protein Q96524 original sequence version: 101 DIP protein Q96524 original sequence version: 110 082E311301465904 cry2-spa1-1 1 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role bait bait Q96524:p.Trp374Ala W374A mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W374A'. Wed May 02 17:33:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp374ala' Tue Jun 30 18:33:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp374Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction cry2-bhlh63-1 3 4 unspecified role unspecified role prey prey ecolx Escherichia coli 6 unspecified role unspecified role bait bait Q96524:p.Trp374Ala W374A mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W374A'. Wed May 02 20:15:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp374ala' Tue Jun 30 19:18:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp374Ala' Q96524:p.Asp387Ala D387A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D387A'. Wed May 02 15:29:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp387ala' Tue Jun 30 20:06:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp387Ala' ecolx Escherichia coli physical association physical association cry2-bhlh63-2 2 4 unspecified role unspecified role prey prey N-terminal domain Region 1-171 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role bait bait Q96524:p.Trp374Ala W374A mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W374A'. Wed May 02 17:49:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp374ala' Tue Jun 30 15:54:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp374Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction