DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. DIP original experiment: DIP-253830X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. DIP original experiment: DIP-253831X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. Only protein-protein interactions ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. DIP original experiment: DIP-253834X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. Only protein-protein interactions ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. DIP original experiment: DIP-253833X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. Only protein-protein interactions ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. DIP original experiment: DIP-253832X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. DIP original experiment: DIP-253829X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. Only protein-protein interactions ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. DIP original experiment: DIP-253835X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. rpob_ecoli DNA-directed RNA polymerase subunit beta rpoB groN nitB rif ron stl stv tabD b3987 Transcriptase subunit beta RNA polymerase subunit beta JW3950 protein protein ecoli Escherichia coli (strain K12) MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKDYIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGILSKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVTDEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKRGGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDLSEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDELKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLKLGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMPESFNVLLKEIRSLGINIELEDE DIP protein P0A8V2 original sequence version: 93 DIP protein P0A8V2 original sequence version: 58 DIP protein P0A8V2 original sequence version: 82 F9E95344C54AB118 rpos_ecoli RNA polymerase sigma factor RpoS Sigma-38 rpoS appR katF nur otsX sigS b2741 JW5437 Sigma S protein protein ecoli Escherichia coli (strain K12) MSQNTLKVHDLNEDAEFDENGVEVFDEKALVEQEPSDNDLAEEELLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLVVKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQTQGLNIEALFRE DIP protein P13445 original sequence version: 126 DIP protein P13445 original sequence version: null 4E6E675E4CA6BC6F ltact_bpt4 Late transcription coactivator Gene product 33 RNA polymerase-associated protein Gp33 33 protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MTQFSLNDIRPVDETGLSEKELSIKKEKDEIAKLLDRQENGFIIEKMVEEFGMSYLEATTAFLEENSIPETQFAKFIPSGIIEKIQSEAIDENLLRPSVVRCEKTNTLDFLL DIP protein P13338 original sequence version: 49 rpod_ecoli RNA polymerase sigma factor RpoD rpoD alt b3067 Sigma-70 JW3039 protein protein ecoli Escherichia coli (strain K12) MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAPDADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATHVGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKAKGRSHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESLRAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD DIP protein P00579 original sequence version: 148 DIP protein P00579 original sequence version: 114 DIP protein P00579 original sequence version: 162 DIP protein P00579 original sequence version: 136 DIP protein P00579 original sequence version: null CA4F0E30DEC1703D rpob-33 7 8 unspecified role unspecified role bait bait Beta-flap domain Region 858-946 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role prey prey P13338:p.Glu70Lys E70K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E K This feature has been corrected as a result of our quality control procedures. The original label was 'E70K'. Wed May 02 20:14:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu70lys' Tue Jun 30 19:02:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu70Lys' ecolx Escherichia coli physical association physical association 33-rpob-1 2 8 unspecified role unspecified role unspecified role unspecified role Beta-flap domain Region 831-1057 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction 33-rpob-2 6 8 unspecified role unspecified role prey prey Beta-flap domain Region 831-1057 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association rpob-rpos-1 3 9 unspecified role unspecified role prey prey Region 243-330 Region 243-330 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role bait bait Beta-flap domain Region 858-946 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0A8V2:p.Glu898Ala E898A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E898A'. Wed May 02 19:59:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu898ala' Tue Jun 30 20:03:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu898Ala' P0A8V2:p.Leu901Ala L901A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L901A'. Wed May 02 15:54:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu901ala' Tue Jun 30 18:51:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu901Ala' P0A8V2:p.Leu902Ala L902A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L902A'. Wed May 02 18:53:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu902ala' Tue Jun 30 18:00:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu902Ala' P0A8V2:p.Arg903Ala R903A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R903A'. Wed May 02 15:36:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg903ala' Tue Jun 30 17:19:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg903Ala' P0A8V2:p.Ile905Ala I905A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I905A'. Wed May 02 18:03:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile905ala' Tue Jun 30 19:09:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile905Ala' P0A8V2:p.Phe906Ala F906A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F906A'. Wed May 02 17:57:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe906ala' Tue Jun 30 18:28:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe906Ala' ecolx Escherichia coli physical association physical association rpob-rpod-5 4 11 unspecified role unspecified role prey prey Region 528-613 Region 528-613 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role bait bait Beta-flap domain Region 858-946 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0A8V2:p.Glu898Ala E898A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E898A'. Wed May 02 14:56:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu898ala' Tue Jun 30 19:58:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu898Ala' P0A8V2:p.Glu899Ala E899A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E899A'. Wed May 02 14:41:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu899ala' Tue Jun 30 15:56:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu899Ala' P0A8V2:p.Lys900Ala K900A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K900A'. Wed May 02 16:00:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys900ala' Tue Jun 30 17:36:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys900Ala' P0A8V2:p.Leu901Ala L901A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L901A'. Wed May 02 17:32:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu901ala' Tue Jun 30 18:24:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu901Ala' P0A8V2:p.Leu902Ala L902A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L902A'. Wed May 02 17:58:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu902ala' Tue Jun 30 17:15:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu902Ala' P0A8V2:p.Arg903Ala R903A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R903A'. Wed May 02 18:09:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg903ala' Tue Jun 30 16:02:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg903Ala' P0A8V2:p.Ile905Ala I905A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I905A'. Wed May 02 17:40:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile905ala' Tue Jun 30 17:26:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile905Ala' P0A8V2:p.Phe906Ala F906A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F906A'. Wed May 02 18:21:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe906ala' Tue Jun 30 16:26:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe906Ala' ecolx Escherichia coli physical association physical association rpob-3 5 8 unspecified role unspecified role bait bait Beta-flap domain Region 858-946 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0A8V2:p.Glu898Ala E898A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E898A'. Wed May 02 17:52:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu898ala' Tue Jun 30 17:48:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu898Ala' P0A8V2:p.Glu899Ala E899A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E899A'. Wed May 02 19:19:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu899ala' Tue Jun 30 16:31:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu899Ala' P0A8V2:p.Lys900Ala K900A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K900A'. Wed May 02 15:13:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys900ala' Tue Jun 30 16:57:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys900Ala' P0A8V2:p.Leu901Ala L901A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L901A'. Wed May 02 20:28:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu901ala' Tue Jun 30 17:45:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu901Ala' P0A8V2:p.Leu902Ala L902A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L902A'. Wed May 02 14:56:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu902ala' Tue Jun 30 20:05:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu902Ala' P0A8V2:p.Arg903Ala R903A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R903A'. Wed May 02 14:55:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg903ala' Tue Jun 30 17:01:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg903Ala' P0A8V2:p.Ile905Ala I905A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I905A'. Wed May 02 15:08:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile905ala' Tue Jun 30 19:28:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile905Ala' P0A8V2:p.Phe906Ala F906A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F906A'. Wed May 02 16:16:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe906ala' Tue Jun 30 19:12:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe906Ala' P0A8V2:p.Lys900Glu K900E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K900E'. Wed May 02 15:31:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys900glu' Tue Jun 30 20:13:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys900Glu' ecolx Escherichia coli 10 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association 33-rpob-3 1 8 unspecified role unspecified role unspecified role unspecified role Beta-flap domain Region 831-1057 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction