DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Displacement of the canonical single-stranded DNA-binding protein in the Thermoproteales. Displacement of the canonical single-stranded DNA-binding protein in the Thermoproteales. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Paytubi S., McMahon SA., Graham S., Liu H., Botting CH., Makarova KS., Koonin EV., Naismith JH., White MF. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Paytubi S., McMahon SA., Graham S., Liu H., Botting CH., Makarova KS., Koonin EV., Naismith JH., White MF. DIP original experiment: DIP-251518X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Displacement of the canonical single-stranded DNA-binding protein in the Thermoproteales. g4rkv8_thetk ssDBP_DBD domain-containing protein TTX_1576 protein protein thetk Thermoproteus tenax (strain ATCC 35583 / DSM 2078 / JCM 9277 / NBRC 100435 / Kra 1) MGEELREEERGEVRSELITKGEKKLVLIRWNTGKTSAGRLFGRYGPGGRPEFFKLLFGAVAGSLREQFGPDGENIFNRIRDSEKFRETSRELFDGLKKWFFEEAVPRYNLERGDIFMISTELVLDPDTGELLWNRDKTQLIYWIRSDRCGGSDAKLREERDRLAKEVELLKAENERLRRELEDVKRKLQQITSLLK DIP protein G4RKV8 original sequence version: 5 g4rkv8_thetk-1 1 2 unspecified role unspecified role unspecified role unspecified role Region 140-196 Region 140-196 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction