DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Agonist-induced PKC phosphorylation regulates GluK2 SUMOylation and kainate receptor endocytosis. Agonist-induced PKC phosphorylation regulates GluK2 SUMOylation and kainate receptor endocytosis. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Konopacki FA., Jaafari N., Rocca DL., Wilkinson KA., Chamberlain S., Rubin P., Kantamneni S., Mellor JR., Henley JM. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Konopacki FA., Jaafari N., Rocca DL., Wilkinson KA., Chamberlain S., Rubin P., Kantamneni S., Mellor JR., Henley JM. DIP original experiment: DIP-253816X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Agonist-induced PKC phosphorylation regulates GluK2 SUMOylation and kainate receptor endocytosis. sumo1_rat Small ubiquitin-related modifier 1 Sumo1 protein protein rat Rattus norvegicus (Rat) Rat MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV DIP protein Q5I0H3 original sequence version: 67 DIP protein Q5I0H3 original sequence version: 28 DIP protein Q5I0H3 original sequence version: 65 mint Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Involved in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4 89BE97D2D054FB33 grik2_rat Glutamate receptor ionotropic, kainate 2 Grik2 Glur6 Glutamate receptor 6 protein protein rat Rattus norvegicus (Rat) Rat MKIISPVLSNLVFSRSIKVLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMERLQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRRLPGKETMA DIP protein P42260 original sequence version: 67 DIP protein P42260 original sequence version: 126 DIP protein P42260 original sequence version: 95 DIP protein P42260 original sequence version: 130 DIP protein P42260 original sequence version: 106 DIP protein P42260 original sequence version: 134 DIP protein P42260 original sequence version: 124 mint 7F430E2D8B2E982B grik2-sumo1-2 1 2 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 3 unspecified role unspecified role bait bait P42260:p.Lys886Arg K886R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K886R'. Wed May 02 18:59:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys886arg' Tue Jun 30 20:06:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys886Arg' YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range rat Rattus norvegicus (Rat) Rat physical association physical association