DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Constitutive coupling of a naturally occurring human alpha1a-adrenergic receptor genetic variant to EGFR transactivation pathway. Constitutive coupling of a naturally occurring human alpha1a-adrenergic receptor genetic variant to EGFR transactivation pathway. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Oganesian A., Yarov-Yarovoy V., Parks WC., Schwinn DA. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Oganesian A., Yarov-Yarovoy V., Parks WC., Schwinn DA. DIP original experiment: DIP-249729X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Constitutive coupling of a naturally occurring human alpha1a-adrenergic receptor genetic variant to EGFR transactivation pathway. arrb1_rat Beta-arrestin-1 Arrb1 Arrestin beta-1 protein protein rat Rattus norvegicus (Rat) Rat MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKDEEDDGTGSPHLNNR DIP protein P29066 original sequence version: 70 DIP protein P29066 original sequence version: 90 DIP protein P29066 original sequence version: 79 0A3C07D71B7ABC55 ada1a_human Alpha-1A adrenergic receptor Alpha-1A adrenoreceptor Alpha-1C adrenergic receptor Alpha-adrenergic receptor 1c ADRA1A ADRA1C protein protein human Homo sapiens Human MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCTTARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV DIP protein P35348 original sequence version: 126 1A50487531DECDF0 adra1a-arrb1-1 1 2 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 3 unspecified role unspecified role bait bait P35348:p.Gly247Arg G247R mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G R This feature has been corrected as a result of our quality control procedures. The original label was 'G247R'. Wed May 02 20:06:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly247arg' Tue Jun 30 18:56:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly247Arg' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range rat Rattus norvegicus (Rat) Rat physical association physical association