DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A conformational switch in the CRIB-PDZ module of Par-6. A conformational switch in the CRIB-PDZ module of Par-6. Structure (London, England : 1993) 2011 imex curation Whitney DS., Peterson FC., Volkman BF. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Whitney DS., Peterson FC., Volkman BF. DIP original experiment: DIP-220143X Structure (London, England : 1993) 2011 IMEx A conformational switch in the CRIB-PDZ module of Par-6. A conformational switch in the CRIB-PDZ module of Par-6. A conformational switch in the CRIB-PDZ module of Par-6. Structure (London, England : 1993) 2011 imex curation Whitney DS., Peterson FC., Volkman BF. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Whitney DS., Peterson FC., Volkman BF. DIP original experiment: DIP-220142X Structure (London, England : 1993) 2011 IMEx A conformational switch in the CRIB-PDZ module of Par-6. ligand PDZ ligand peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) VKESLV cdc42_drome Cdc42 homolog CG12530 Cdc42 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRKCKFL DIP protein P40793 original sequence version: 109 0AB96574ADC8E0E3 o97111_drome par-6 DPar-6 DPar6 Dm-Par-6 Dm-Par6 DmPAR-6 DmPar-6 DmPar6 Dmel\CG5884 Dmpar6 PAR-6 PAR6 Par Par-6 Par6 dPAR-6 dPar-6 dmPar-6 par par6 Dmel_CG5884 CG5884 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSKNKINTTSATAASDTNLIEVKSKFDAEFRRWSFKRNEAEQSFDKFASLIEQLHKLTNIQFLILYIDPRDNDLLPINNDDNFGRALKTARPLLRVIVQRKDDLNEYSGFGTMKPRNLIGSILMGHTPVKTKAPSISIPHDFRQVSAIIDVDIVPETHRRVRLLKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFISRLVPGGLAESTGLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITVKPANQRTLTSTHRGSFSRNSQLSSGSHHTNNTNTSDEIEHDDQDDIVDLTGVTLDESPTSTSAGNHNHQPPLSSSPSSHHQQAASNASTIMASDVKDGVLHL DIP protein O97111 original sequence version: 97 3097047D5348C84C ligand-par_6-1 2 3 unspecified role unspecified role unspecified role unspecified role Rhodamine-label Rhodamine-label fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 5 unspecified role unspecified role unspecified role unspecified role PDZ domain Region 156-255 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O97111:p.[Gln144Cys;Leu164Cys] Q144C/L164C mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L C certain certain sequence position certain certain certain sequence position certain Q C This feature has been corrected as a result of our quality control procedures. The original label was 'Q144C/L164C'. Wed May 02 16:44:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln144cys,leu164cys' Tue Jun 30 19:09:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln144Cys;Leu164Cys]' O97111:p.Lys165Leu K165L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K L This feature has been corrected as a result of our quality control procedures. The original label was 'K165L'. Wed May 02 19:17:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys165leu' Tue Jun 30 15:57:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys165Leu' O97111:p.Leu164Glu L164E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L E This feature has been corrected as a result of our quality control procedures. The original label was 'L164E'. Wed May 02 18:50:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu164glu' Tue Jun 30 19:38:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu164Glu' O97111:p.Leu164Lys L164K mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L K This feature has been corrected as a result of our quality control procedures. The original label was 'L164K'. Wed May 02 18:29:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu164lys' Tue Jun 30 19:03:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu164Lys' ecolx Escherichia coli direct interaction direct interaction cdc42-par_6-1 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role CRIB-PDZ domain Region 130-255 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction