DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220392X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220391X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220405X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220407X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220396X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220406X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220397X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220394X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220409X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220400X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220403X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220404X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220398X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220408X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220410X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220402X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220399X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220395X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220393X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Nature structural & molecular biology 2011 imex curation Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Hong SB., Kim BW., Lee KE., Kim SW., Jeon H., Kim J., Song HK. DIP original experiment: DIP-220401X Nature structural & molecular biology 2011 IMEx Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. atg10_yeast Ubiquitin-like-conjugating enzyme ATG10 Autophagy-related protein 10 ATG10 YLL042C APG10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIPYQEWHSQLQSLYDSQIFHNWALCQDVHLNDEKDGLLLRLIPTRQLQKNTERIENKLLNHIELYLTYSKVYNEPLLLLRIWEEKSIDGIPMTKLMLPTDIESLLDVQGKFQLGLDTIINLEGSVWYSFHPCDTSCIVGDQAEFMSTYLRRWVSIFIFSWLGYEDS 9B90684B8D3D26C5 9B90684B8D3D26C5 atg3_yeast Autophagy-related protein 3 Autophagy-related E2-like conjugation enzyme ATG3 ATG3 AUT1 YNR007C N2040 APG3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIRSTLSSWREYLTPITHKSTFLTTGQITPEEFVQAGDYLCHMFPTWKWNEESSDISYRDFLPKNKQFLIIRKVPCDKRAEQCVEVEGPDVIMKGFAEDGDEDDVLEYIGSETEHVQSTPAGGTKDSSIDDIDELIQDMEIKEEDENDDTEEFNAKGGLAKDMAQERYYDLYIAYSTSYRVPKMYIVGFNSNGSPLSPEQMFEDISADYRTKTATIEKLPFYKNSVLSVSIHPCKHANVMKILLDKVRVVRQRRRKELQEEQELDGVGDWEDLQDDIDDSLRVDQYLIVFLKFITSVTPSIQHDYTMEGW 52CCFB216B18CF0C 52CCFB216B18CF0C mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV DIP protein Q9GZQ8 original sequence version: 69 DIP protein Q9GZQ8 original sequence version: 108 DIP protein Q9GZQ8 original sequence version: 129 DIP protein Q9GZQ8 original sequence version: 132 DIP protein Q9GZQ8 original sequence version: 148 DIP protein Q9GZQ8 original sequence version: 152 DIP protein Q9GZQ8 original sequence version: 111 DIP protein Q9GZQ8 original sequence version: 153 BB141DEC7653E83F atg7_yeast Ubiquitin-like modifier-activating enzyme ATG7 ATG7 APG7 CVT2 ATG12-activating enzyme E1 ATG7 Cytoplasm to vacuole targeting protein 2 Autophagy-related protein 7 YHR171W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSERVLSYAPAFKSFLDTSFFQELSRLKLDVLKLDSTCQPLTVNLDLHNIPKSADQVPLFLTNRSFEKHNNKRTNEVPLQGSIFNFNVLDEFKNLDKQLFLHQRALECWEDGIKDINKCVSFVIISFADLKKYRFYYWLGVPCFQRPSSTVLHVRPEPSLKGLFSKCQKWFDVNYSKWVCILDADDEIVNYDKCIIRKTKVLAIRDTSTMENVPSALTKNFLSVLQYDVPDLIDFKLLIIRQNEGSFALNATFASIDPQSSSSNPDMKVSGWERNVQGKLAPRVVDLSSLLDPLKIADQSVDLNLKLMKWRILPDLNLDIIKNTKVLLLGAGTLGCYVSRALIAWGVRKITFVDNGTVSYSNPVRQALYNFEDCGKPKAELAAASLKRIFPLMDATGVKLSIPMIGHKLVNEEAQHKDFDRLRALIKEHDIIFLLVDSRESRWLPSLLSNIENKTVINAALGFDSYLVMRHGNRDEQSSKQLGCYFCHDVVAPTDSLTDRTLDQMCTVTRPGVAMMASSLAVELMTSLLQTKYSGSETTVLGDIPHQIRGFLHNFSILKLETPAYEHCPACSPKVIEAFTDLGWEFVKKALEHPLYLEEISGLSVIKQEVERLGNDVFEWEDDESDEIA 561EEC94F0ED57F5 561EEC94F0ED57F5 atg8_yeast Autophagy-related protein 8 ATG8 APG8 AUT7 YBL078C YBL0732 CVT5 Autophagy-related ubiquitin-like modifier ATG8 Cytoplasm to vacuole targeting protein 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR 1246CEFF5A038819 1246CEFF5A038819 atg7-1 10 24 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction atg10-atg7-4 18 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-294 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction atg7-atg8-2 2 25 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 293-630 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction atg7-atg8-3 15 25 unspecified role unspecified role unspecified role unspecified role P38182:p.Tyr62Lys Y62K mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y K This feature has been corrected as a result of our quality control procedures. The original label was 'Y62K'. Wed May 02 20:02:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr62lys' Tue Jun 30 19:24:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr62Lys' ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 293-630 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction atg3-atg8-2 3 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 25 unspecified role unspecified role unspecified role unspecified role P38182:p.Tyr62Lys Y62K mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y K This feature has been corrected as a result of our quality control procedures. The original label was 'Y62K'. Wed May 02 20:14:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr62lys' Tue Jun 30 17:23:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr62Lys' ecolx Escherichia coli physical association physical association atg7-map1lc3b-1 16 23 unspecified role unspecified role unspecified role unspecified role Q9GZQ8:p.Lys65Tyr K65Y mutation increasing mutation increasing interaction mutation increasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K Y This feature has been corrected as a result of our quality control procedures. The original label was 'K65Y'. Wed May 02 15:58:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys65tyr' Tue Jun 30 18:22:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys65Tyr' ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 293-630 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction atg3-atg7-3 5 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-294 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction atg7-atg8-4 1 25 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 293-630 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 616-630 Δ616-630 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P38862:p.Glu612Ala E612A/Q/R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E A Wed May 02 16:04:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu612ala' Tue Jun 30 18:04:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu612Ala' P38862:p.Glu612Gln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E Q Wed May 02 16:22:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu612gln' Tue Jun 30 18:39:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu612Gln' P38862:p.Glu612Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E R Wed May 02 17:50:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu612arg' Tue Jun 30 19:38:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu612Arg' ecolx Escherichia coli covalent binding covalent binding atg7-map1lc3b-2 9 24 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role Q9GZQ8:p.Lys65Tyr K65Y mutation increasing mutation increasing interaction mutation increasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K Y This feature has been corrected as a result of our quality control procedures. The original label was 'K65Y'. Wed May 02 17:33:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys65tyr' Tue Jun 30 18:03:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys65Tyr' ecolx Escherichia coli direct interaction direct interaction atg10-atg7-5 6 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-294 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction atg7-4 20 24 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction atg3-atg7-4 11 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 25 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association atg10-atg7-6 7 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-294 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction atg3-atg7-5 19 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 25 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-294 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association atg3-atg7-6 4 22 unspecified role unspecified role unspecified role unspecified role Region 84-161 Region 84-161 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-294 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction atg7-atg8-5 12 25 unspecified role unspecified role unspecified role unspecified role P38182:p.Tyr62Lys Y62K mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y K This feature has been corrected as a result of our quality control procedures. The original label was 'Y62K'. Wed May 02 15:16:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr62lys' Tue Jun 30 18:30:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr62Lys' ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association atg3-atg7-7 8 22 unspecified role unspecified role unspecified role unspecified role Region 84-161 Region 84-161 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-294 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction atg3-map1lc3b-1 13 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction atg3-map1lc3b-2 17 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction atg7-atg8-6 14 25 unspecified role unspecified role unspecified role unspecified role P38182:p.Tyr62Lys Y62K/A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y K Wed May 02 16:39:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr62lys' Tue Jun 30 16:17:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr62Lys' P38182:p.Lys66Glu K66E/A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 19:14:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys66glu' Tue Jun 30 19:47:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys66Glu' P38182:p.[Tyr62Ala;Lys66Ala] Y62A/K66A mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y62A/K66A'. Wed May 02 20:31:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr62ala,lys66ala' Tue Jun 30 19:36:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr62Ala;Lys66Ala]' P38182:p.Tyr62Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 16:34:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr62ala' Tue Jun 30 18:53:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr62Ala' P38182:p.Lys66Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 16:34:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys66ala' Tue Jun 30 19:47:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys66Ala' ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 293-630 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli covalent binding covalent binding