DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Nature 2011 imex curation Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. DIP original experiment: DIP-220297X Nature 2011 IMEx Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Nature 2011 imex curation Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. DIP original experiment: DIP-220299X Nature 2011 IMEx Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Nature 2011 imex curation Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. DIP original experiment: DIP-220300X Nature 2011 IMEx Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Nature 2011 imex curation Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. DIP original experiment: DIP-220298X Nature 2011 IMEx Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Nature 2011 imex curation Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. DIP original experiment: DIP-220301X Nature 2011 IMEx Adherens junction protein nectin-4 is the epithelial receptor for measles virus. nect4_human Nectin-4 NECTIN4 Ig superfamily receptor LNIR LNIR Nectin cell adhesion molecule 4 PRR4 PVRL4 Poliovirus receptor-related protein 4 protein protein human Homo sapiens Human MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPALEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTTSSRSFKHSRSAAVTSEFHLVPSRSMNGQPLTCVVSHPGLLQDQRITHILHVSFLAEASVRGLEDQNLWHIGREGAMLKCLSEGQPPPSYNWTRLDGPLPSGVRVDGDTLGFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDVLDPQEDSGKQVDLVSASVVVVGVIAALLFCLLVVVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEESVGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGSGRAEEEEDQDEGIKQAMNHFVQENGTLRAKPTGNGIYINGRGHLV DIP protein Q96NY8 original sequence version: 100 DIP protein Q96NY8 original sequence version: 105 DIP protein Q96NY8 original sequence version: 90 DIP protein Q96NY8 original sequence version: 97 DCF5E1D794F227FA slaf1_human Signaling lymphocytic activation molecule SLAMF1 SLAM family member 1 SLAM CDw150 IPO-3 protein protein human Homo sapiens Human MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES DIP protein Q13291 original sequence version: 151 DIP protein Q13291 original sequence version: 110 DIP protein Q13291 original sequence version: 106 DIP protein Q13291 original sequence version: 112 BFB0F27EA31D8C04 hema_measc Hemagglutinin glycoprotein H protein protein measc measles virus (strai MSPQRDRINAFYKDNPHPKGSRIVINREHLMIDRPYVLLAVLFVMFLSLIGLLAIAGIRLHRAAIYTAEIHKSLSTNLDVTNSIEHQVKDVLTPLFKIIGDEVGLRTPQRFTDLVKFISDKIKFLNPDREYDFRDLTWCINPPERIKLDYDQYCADVAAEELMNALVNSTLLEARATNQFLAVSKGNCSGPTTIRGQFSNMSLSLLDLYLSRGYNVSSIVTMTSQGMYGGTYLVGKPNLSSKGSELSQLSMHRVFEVGVIRNPGLGAPVFHMTNYFEQPVSNDFSNCMVALGELKFAALCHREDSITIPYQGSGKGVSFQLVKLGVWKSPTDMRSWVPLSTDDPVIDRLYLSSHRGVIADNQAKWAVPTTRTDDKLRMETCFQQACKGKNQALCENPEWAPLKDNRIPSYGVLSVNLSLTVELKIKIASGFGPLITHGSGMDLYKTNHNNVYWLTIPPMKNLALGVINTLEWIPRFKVSPNLFTVPIKEAGEDCHAPTYLPAEVDGDVKLSSNLVILPGQDLQYVLATYDTSRVEHAVVYYVYSPSRSFSYFYPFRLPIKGVPIELQVECFTWDKKLWCRHFCVLADSESGGHITHSGMVGMGVSCTVTREDGTNRR DIP protein Q786F2 original sequence version: 18 DIP protein Q786F2 original sequence version: 11 7E877598258DEC5E nectin4-h-1 2 8 unspecified role unspecified role prey prey Ectodomain Region 60-617 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 6 unspecified role unspecified role bait bait Region 1-141 Region 1-141 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction h-nectin4-2 1 8 unspecified role unspecified role bait bait Ectodomain Region 60-617 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 6 unspecified role unspecified role prey prey Ectodomain Region 1-331 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction nectin4-h-2 5 8 unspecified role unspecified role prey prey Ectodomain Region 60-617 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 6 unspecified role unspecified role bait bait Region 1-141 Region 1-141 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association slamf1-h-2 3 7 unspecified role unspecified role bait bait Ectodomain Region 21-230 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 8 unspecified role unspecified role prey prey Ectodomain Region 60-617 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction h-slamf1-2 4 7 unspecified role unspecified role prey prey Ectodomain Region 21-230 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 8 unspecified role unspecified role bait bait Ectodomain Region 60-617 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction