DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. Nature structural & molecular biology 2011 imex curation Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. DIP original experiment: DIP-220367X Nature structural & molecular biology 2011 IMEx An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. Nature structural & molecular biology 2011 imex curation Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. DIP original experiment: DIP-220376X Nature structural & molecular biology 2011 IMEx An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. Nature structural & molecular biology 2011 imex curation Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. DIP original experiment: DIP-220368X Nature structural & molecular biology 2011 IMEx An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. Nature structural & molecular biology 2011 imex curation Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. DIP original experiment: DIP-220373X Nature structural & molecular biology 2011 IMEx An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. Nature structural & molecular biology 2011 imex curation Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. DIP original experiment: DIP-220365X Nature structural & molecular biology 2011 IMEx An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. Nature structural & molecular biology 2011 imex curation Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. DIP original experiment: DIP-220363X Nature structural & molecular biology 2011 IMEx An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. Nature structural & molecular biology 2011 imex curation Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. DIP original experiment: DIP-220377X Nature structural & molecular biology 2011 IMEx An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. Nature structural & molecular biology 2011 imex curation Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. DIP original experiment: DIP-220371X Nature structural & molecular biology 2011 IMEx An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. Nature structural & molecular biology 2011 imex curation Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. DIP original experiment: DIP-220364X Nature structural & molecular biology 2011 IMEx An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. Nature structural & molecular biology 2011 imex curation Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. DIP original experiment: DIP-220369X Nature structural & molecular biology 2011 IMEx An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. Nature structural & molecular biology 2011 imex curation Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. DIP original experiment: DIP-220370X Nature structural & molecular biology 2011 IMEx An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. Nature structural & molecular biology 2011 imex curation Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. DIP original experiment: DIP-220374X Nature structural & molecular biology 2011 IMEx An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. Nature structural & molecular biology 2011 imex curation Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. DIP original experiment: DIP-220375X Nature structural & molecular biology 2011 IMEx An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. Nature structural & molecular biology 2011 imex curation Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. DIP original experiment: DIP-220372X Nature structural & molecular biology 2011 IMEx An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. An asymmetric interface between the regulatory and core particles of the proteasome. Nature structural & molecular biology 2011 imex curation Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Tian G., Park S., Lee MJ., Huck B., McAllister F., Hill CP., Gygi SP., Finley D. DIP original experiment: DIP-220366X Nature structural & molecular biology 2011 IMEx An asymmetric interface between the regulatory and core particles of the proteasome. prs6a_yeast 26S proteasome regulatory subunit 6A RPT5 YTA1 YOR117W O3258 YOR3258W Tat-binding protein homolog 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MATLEELDAQTLPGDDELDQEILNLSTQELQTRAKLLDNEIRIFRSELQRLSHENNVMLEKIKDNKEKIKNNRQLPYLVANVVEVMDMNEIEDKENSESTTQGGNVNLDNTAVGKAAVVKTSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQARKSKSVSFYA C215422033FCE830 C215422033FCE830 prs8_yeast 26S proteasome regulatory subunit 8 homolog TBPY TBY1 YGL048C RPT6 CIM3 CRL3 SUG1 Protein SUG1 Protein CIM3 Tat-binding protein TBY1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTAAVTSSNIVLETHESGIKPYFEQKIQETELKIRSKTENVRRLEAQRNALNDKVRFIKDELRLLQEPGSYVGEVIKIVSDKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQETAISVAKLFK 9C59E92A0794F60F 9C59E92A0794F60F prs10_yeast 26S proteasome subunit RPT4 RPT4 CRL13 PCS1 SUG2 26S protease subunit SUG2 Proteasomal cap subunit YOR259C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEEQDPLLAGLGETSGDNHTQQSHEQQPEQPQETEEHHEEEPSRVDPEQEAHNKALNQFKRKLLEHRRYDDQLKQRRQNIRDLEKLYDKTENDIKALQSIGQLIGEVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQGEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDLMKAVRKVAEVKKLEGTIEYQKL 0EA42A599E2B2E2A 0EA42A599E2B2E2A psa3_yeast Proteasome subunit alpha type-3 PRE9 YGR135W PRS5 Proteasome component Y13 Macropain subunit Y13 Proteinase YSCE subunit 13 Multicatalytic endopeptidase complex subunit Y13 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGITKKDEDEEADEDMK B43BB05233A01A9E B43BB05233A01A9E prs7_yeast 26S proteasome regulatory subunit 7 homolog YKL145W RPT1 CIM5 YTA3 Protein CIM5 Tat-binding homolog 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPPKEDWEKYKAPLEDDDKKPDDDKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGESDETTTDNNNSGNSNSNSNQQSTDADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 8454BBC9D549EC5C 8454BBC9D549EC5C psa1_yeast Proteasome subunit alpha type-1 SCL1 PRC2 PRS2 YGL011C Proteasome component C7-alpha Macropain subunit C7-alpha Proteinase YSCE subunit 7 Multicatalytic endopeptidase complex C7 Proteasome component Y8 SCL1 suppressor protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGAAAASAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQD 5B938C862BC8D7EB 5B938C862BC8D7EB prs6b_yeast 26S proteasome regulatory subunit 6B homolog RPT3 YNT1 YTA2 YDR394W D9509.14 Protein YNT1 Tat-binding homolog 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEELGIVTPVEKAVEEKPAVKSYASLLAQLNGTVNNNSALSNVNSDIYFKLKKLEKEYELLTLQEDYIKDEQRHLKRELKRAQEEVKRIQSVPLVIGQFLEPIDQNTGIVSSTTGMSYVVRILSTLDRELLKPSMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVKTDNTVDKFDFYK E12F0995A60732BD E12F0995A60732BD psa4_yeast Proteasome subunit alpha type-4 PRE6 YOL038W Proteasome component PRE6 Macropain subunit PRE6 Proteinase YSCE subunit PRE6 Multicatalytic endopeptidase complex subunit PRE6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQQEQDKKKKSNH 73AEE63B836E618A 73AEE63B836E618A prs4_yeast 26S proteasome regulatory subunit 4 homolog RPT2 YHS4 YTA5 YDL007W D2920 Tat-binding homolog 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGQGVSSGQDKKKKKGSNQKPKYEPPVQSKFGRKKRKGGPATAEKLPNIYPSTRCKLKLLRMERIKDHLLLEEEFVSNSEILKPFEKKQEEEKKQLEEIRGNPLSIGTLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYL EB735354C3A0EBD4 EB735354C3A0EBD4 psa6_yeast Proteasome subunit alpha type-6 PRE5 YMR314W YM9924.06 Proteasome component PRE5 Macropain subunit PRE5 Proteinase YSCE subunit PRE5 Multicatalytic endopeptidase complex subunit PRE5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI C43CBCC1C6B9E39E C43CBCC1C6B9E39E rpn11_yeast Ubiquitin carboxyl-terminal hydrolase RPN11 YFR004W RPN11 MPR1 Protein MPR1 26S proteasome regulatory subunit RPN11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MERLQRLMMNSKVGSADTGRDDTKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNLEPRQTTSNTGLLNKANIQALIHGLNRHYYSLNIDYHKTAKETKMLMNLHKEQWQSGLKMYDYEEKEESNLAATKSMVKIAEQYSKRIEEEKELTEEELKTRYVGRQDPKKHLSETADETLENNIVSVLTAGVNSVAIK 9DDE8BD74890894D 9DDE8BD74890894D psa5_yeast Proteasome subunit alpha type-5 PUP2 DOA5 YGR253C G9155 Proteasome component PUP2 Macropain subunit PUP2 Proteinase YSCE subunit PUP2 Multicatalytic endopeptidase complex subunit PUP2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAESPEEADVEMS E8EDEB212BF4EC6E E8EDEB212BF4EC6E psa7_yeast Probable proteasome subunit alpha type-7 PRE10 PRC1 PRS1 O6650 YOR362C Proteasome component C1 Macropain subunit C1 Proteinase YSCE subunit 1 Multicatalytic endopeptidase complex subunit C1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEINGDDDEDEDDSDNVMSSDDENAPVATNANATTDQEGDIHLE 1E51D904CF336747 1E51D904CF336747 psa2_yeast Proteasome subunit alpha type-2 PRE8 PRS4 YML092C Proteasome component Y7 Macropain subunit Y7 Proteinase YSCE subunit 7 Multicatalytic endopeptidase complex subunit Y7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL 12D7DFB1AA10E9FE 12D7DFB1AA10E9FE rpn11-alpha_1-1 6 21 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait ProteinA-tag ProteinA-tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpt4-rpt5-5 2 16 unspecified role unspecified role unspecified role unspecified role P33297:p.Glu84Cys E84C mutation mutation certain certain sequence position certain certain certain sequence position certain E C This feature has been corrected as a result of our quality control procedures. The original label was 'E84C'. Wed May 02 19:41:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu84cys' Tue Jun 30 19:29:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu84Cys' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role unspecified role unspecified role P53549:p.Arg145Cys R145C mutation mutation certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R145C'. Wed May 02 16:13:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg145cys' Tue Jun 30 20:21:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg145Cys' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpn11-alpha_5-1 1 27 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait ProteinA-tag ProteinA-tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpn11-rpt4-3 14 18 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait ProteinA-tag ProteinA-tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpn11-rpt3-3 8 22 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait ProteinA-tag ProteinA-tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpn11-alpha_2-1 9 29 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait ProteinA-tag ProteinA-tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpn11-rpt2-5 7 24 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait ProteinA-tag ProteinA-tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpn11-rpt5-4 4 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait ProteinA-tag ProteinA-tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpn11-alpha_6-1 3 25 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait ProteinA-tag ProteinA-tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpn11-alpha_3-1 5 19 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait ProteinA-tag ProteinA-tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpn11-rpt6-3 12 17 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait ProteinA-tag ProteinA-tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpn11-alpha_7-1 10 28 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait ProteinA-tag ProteinA-tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpn11-alpha_4-1 15 23 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait ProteinA-tag ProteinA-tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpt1-rpt2-4 13 24 unspecified role unspecified role unspecified role unspecified role P40327:p.Glu111Cys E111C mutation mutation certain certain sequence position certain certain certain sequence position certain E C This feature has been corrected as a result of our quality control procedures. The original label was 'E111C'. Wed May 02 18:02:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu111cys' Tue Jun 30 15:39:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu111Cys' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role unspecified role unspecified role P33299:p.Arg173Cys R173C mutation mutation certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R173C'. Wed May 02 17:05:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg173cys' Tue Jun 30 18:27:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg173Cys' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpn11-rpt1-5 11 20 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait ProteinA-tag ProteinA-tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association