DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A SUMOylation-defective MITF germline mutation predisposes to melanoma and renal carcinoma. A SUMOylation-defective MITF germline mutation predisposes to melanoma and renal carcinoma. Nature 2011 imex curation Bertolotto C., Lesueur F., Giuliano S., Strub T., de Lichy M., Bille K., Dessen P., d'Hayer B., Mohamdi H., Remenieras A., Maubec E., de la Fouchardière A., Molinié V., Vabres P., Dalle S., Poulalhon N., Martin-Denavit T., Thomas L., Andry-Benzaquen P., Dupin N., Boitier F., Rossi A., Perrot JL., Labeille B., Robert C., Escudier B., Caron O., Brugières L., Saule S., Gardie B., Gad S., Richard S., Couturier J., Teh BT., Ghiorzo P., Pastorino L., Puig S., Badenas C., Olsson H., Ingvar C., Rouleau E., Lidereau R., Bahadoran P., Vielh P., Corda E., Blanché H., Zelenika D., Galan P., null null., Aubin F., Bachollet B., Becuwe C., Berthet P., Bignon YJ., Bonadona V., Bonafe JL., Bonnet-Dupeyron MN., Cambazard F., Chevrant-Breton J., Coupier I., Dalac S., Demange L., d'Incan M., Dugast C., Faivre L., Vincent-Fétita L., Gauthier-Villars M., Gilbert B., Grange F., Grob JJ., Humbert P., Janin N., Joly P., Kerob D., Lasset C., Leroux D., Levang J., Limacher JM., Livideanu C., Longy M., Lortholary A., Stoppa-Lyonnet D., Mansard S., Mansuy L., Marrou K., Matéus C., Maugard C., Meyer N., Nogues C., Souteyrand P., Venat-Bouvet L., Zattara H., Chaudru V., Lenoir GM., Lathrop M., Davidson I., Avril MF., Demenais F., Ballotti R., Bressac-de Paillerets B. Only protein-protein interactions human Homo sapiens Human pull down pull down predetermined predetermined participant predetermined Bertolotto C., Lesueur F., Giuliano S., Strub T., de Lichy M., Bille K., Dessen P., d'Hayer B., Mohamdi H., Remenieras A., Maubec E., de la Fouchardière A., Molinié V., Vabres P., Dalle S., Poulalhon N., Martin-Denavit T., Thomas L., Andry-Benzaquen P., Dupin N., Boitier F., Rossi A., Perrot JL., Labeille B., Robert C., Escudier B., Caron O., Brugières L., Saule S., Gardie B., Gad S., Richard S., Couturier J., Teh BT., Ghiorzo P., Pastorino L., Puig S., Badenas C., Olsson H., Ingvar C., Rouleau E., Lidereau R., Bahadoran P., Vielh P., Corda E., Blanché H., Zelenika D., Galan P., null null., Aubin F., Bachollet B., Becuwe C., Berthet P., Bignon YJ., Bonadona V., Bonafe JL., Bonnet-Dupeyron MN., Cambazard F., Chevrant-Breton J., Coupier I., Dalac S., Demange L., d'Incan M., Dugast C., Faivre L., Vincent-Fétita L., Gauthier-Villars M., Gilbert B., Grange F., Grob JJ., Humbert P., Janin N., Joly P., Kerob D., Lasset C., Leroux D., Levang J., Limacher JM., Livideanu C., Longy M., Lortholary A., Stoppa-Lyonnet D., Mansard S., Mansuy L., Marrou K., Matéus C., Maugard C., Meyer N., Nogues C., Souteyrand P., Venat-Bouvet L., Zattara H., Chaudru V., Lenoir GM., Lathrop M., Davidson I., Avril MF., Demenais F., Ballotti R., Bressac-de Paillerets B. DIP original experiment: DIP-248986X Nature 2011 IMEx A SUMOylation-defective MITF germline mutation predisposes to melanoma and renal carcinoma. sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV DIP protein P63165 original sequence version: 36 DIP protein P63165 original sequence version: 40 DIP protein P63165 original sequence version: 124 DIP protein P63165 original sequence version: 125 DIP protein P63165 original sequence version: 83 DIP protein P63165 original sequence version: 85 DIP protein P63165 original sequence version: 81 DIP protein P63165 original sequence version: 84 DIP protein P63165 original sequence version: 103 DIP protein P63165 original sequence version: 100 DIP protein P63165 original sequence version: 95 DIP protein P63165 original sequence version: 98 DIP protein P63165 original sequence version: 101 DIP protein P63165-1 original sequence version: 131 DIP protein P63165 original sequence version: 102 DIP protein P63165 original sequence version: 122 DIP protein P63165 original sequence version: 62 DIP protein P63165 original sequence version: 119 DIP protein P63165 original sequence version: 82 89BE97D2D054FB33 o75030-9 Microphthalmia-associated transcription factor MITF BHLHE32 Class E basic helix-loop-helix protein 32 protein protein human Homo sapiens Human MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEGFYKFEEQNRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEEILGLMDPALQMANTLPVSGNLIDLYGNQGLPPPGLTISNSCPANLPNIKRELTACIFPTESEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHTC DIP protein O75030-9 original sequence version: 122 sumo1-mitf-1 1 2 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 3 unspecified role unspecified role prey prey O75030-9:p.Glu318Lys E318K mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E K This feature has been corrected as a result of our quality control procedures. The original label was 'E318K'. Wed May 02 17:49:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu318lys' Tue Jun 30 15:50:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu318Lys' O75030-9:p.[Lys182Arg;Glu318Lys] E318K/K182R mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E K certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'E318K/K182R'. Wed May 02 16:33:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys182arg,glu318lys' Tue Jun 30 18:06:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys182Arg;Glu318Lys]' Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association