DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Protein LidA from Legionella is a Rab GTPase supereffector. Protein LidA from Legionella is a Rab GTPase supereffector. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250172X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Protein LidA from Legionella is a Rab GTPase supereffector. Protein LidA from Legionella is a Rab GTPase supereffector. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250177X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Protein LidA from Legionella is a Rab GTPase supereffector. Protein LidA from Legionella is a Rab GTPase supereffector. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250175X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Protein LidA from Legionella is a Rab GTPase supereffector. Protein LidA from Legionella is a Rab GTPase supereffector. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250173X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Protein LidA from Legionella is a Rab GTPase supereffector. Protein LidA from Legionella is a Rab GTPase supereffector. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250176X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Protein LidA from Legionella is a Rab GTPase supereffector. Protein LidA from Legionella is a Rab GTPase supereffector. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250174X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Protein LidA from Legionella is a Rab GTPase supereffector. Protein LidA from Legionella is a Rab GTPase supereffector. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250171X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Protein LidA from Legionella is a Rab GTPase supereffector. Protein LidA from Legionella is a Rab GTPase supereffector. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250178X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. rab1b_human Ras-related protein Rab-1B RAB1B protein protein human Homo sapiens Human MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC DIP protein Q9H0U4 original sequence version: 124 DIP protein Q9H0U4 original sequence version: 114 9812FF4DAC34B2BE rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL DIP protein P61006 original sequence version: 82 DIP protein P61006 original sequence version: 100 DIP protein P61006 original sequence version: 128 DIP protein P61006 original sequence version: 132 AA52DBF54A2CD056 p20340-1 Ras-related protein Rab-6A Rab-6a RAB6A RAB6 protein protein human Homo sapiens Human MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSEGGCSC DIP protein P20340-1 original sequence version: 121 DIP protein P20340 original sequence version: 125 DIP protein P20340 original sequence version: 149 C9A3C2DDBF6C3E9E q5zwz3_legph lpg0940 protein protein legph Legionella pneumophila subsp. pneumophila MAKDNKSHQVKTSEGSLESVKTKEKEPVLEKMRVEDSKKEDKLSMPTTKKESQPNEPVKPFKTSFEKWIESSLLDPQAKEDRGSTINLGREGLKNASQVKKFLLSPAGKDVIAELGAQMALQRNINLQNQQDRMEHELFKRRLMAALFLWYLSKKSHAAEKVKEIIREYNEKAIKNAEKASKPSQQSTSSTSQADKEIQKMLDEYEQAIKRAQENIKKGEELEKKLDKLERQGKDLEDKYKTYEENLEGFEKLLTDSEELSLSEINEKMEAFSKDSEKLTQLMEKHKGDEKTVQSLQREHHDIKAKLANLQVLHDAHTGKKSYVNEKGNPVSSLKDAHLAINKDQEVVEHEGQFYLLQKGQWDAIKNNPAALEKAQKDYSQSKHDLATIKMEALIHKLSLEMEKQLETINNLIMSTDPKENEEATKLLHKHNGLNLKLANLQDMLAVHRKEKSFFNEKGEEVTSLNDAHYVIGKDQQLFNLGGKFYPIHKEQKILEKDGKFYLLKQGEDWESIKDSPEKQKKAEHDFHKLQYETPMTVKKLVHHNKGLETTIHKERVEETKQQLEDNGKEKIEIANNISKLQSTVGVALNQLNQPTLDTESPVLTPSGGSTTSSPKPTPSLASVTTFFKTKIDEMKKNENVKVTFDDLLALSIKIADPKARTYFTGELLKEVPRSGAIPFQTMQRMLQTLEQYGVDTTKPSVTSIRSKTDEVLEQRFNPTPSLSPFKTS DIP protein Q5ZWZ3 original sequence version: 43 047D2B25EEBE332D q5zwz3_legph-rab1b-1 5 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 201-583 Region 201-583 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q5zwz3_legph-rab8a-1 7 10 unspecified role unspecified role unspecified role unspecified role Region 6-176 Region 6-176 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 201-583 Region 201-583 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q5zwz3_legph-rab8a-2 8 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 201-583 Region 201-583 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q5zwz3_legph-rab6a-1 6 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction q5zwz3_legph-rab8a-3 1 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction q5zwz3_legph-rab1b-2 3 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 201-583 Region 201-583 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q5zwz3_legph-rab6a-2 2 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 201-583 Region 201-583 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q5zwz3_legph-rab1b-3 4 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction