DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Structure (London, England : 1993) 2011 imex curation Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. DIP original experiment: DIP-220094X Structure (London, England : 1993) 2011 IMEx Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Structure (London, England : 1993) 2011 imex curation Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. DIP original experiment: DIP-220092X Structure (London, England : 1993) 2011 IMEx Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Structure (London, England : 1993) 2011 imex curation Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. DIP original experiment: DIP-220089X Structure (London, England : 1993) 2011 IMEx Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Structure (London, England : 1993) 2011 imex curation Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. DIP original experiment: DIP-220091X Structure (London, England : 1993) 2011 IMEx Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Structure (London, England : 1993) 2011 imex curation Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. DIP original experiment: DIP-220088X Structure (London, England : 1993) 2011 IMEx Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Structure (London, England : 1993) 2011 imex curation Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. DIP original experiment: DIP-220093X Structure (London, England : 1993) 2011 IMEx Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Structure (London, England : 1993) 2011 imex curation Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. DIP original experiment: DIP-220090X Structure (London, England : 1993) 2011 IMEx Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. bim BIM peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) DMRPEIWIAQELRRIGDEFNAYYARR b2cl2_human Bcl-2-like protein 2 Apoptosis regulator Bcl-W BCL2L2 BCLW KIAA0271 protein protein human Homo sapiens Human MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK DIP protein Q92843 original sequence version: 103 DIP protein Q92843 original sequence version: 85 DIP protein Q92843 original sequence version: 112 3542243A532B1762 bad_human Bcl2-associated agonist of cell death Bcl-2-binding component 6 Bcl-2-like protein 8 BAD BBC6 BCL2L8 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein human Homo sapiens Human MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ DIP protein Q92934 original sequence version: 66 DIP protein Q92934 original sequence version: 121 69FD8D27DDEE3241 puma PUMA peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) EEQWAREIGAQLRRMADDLNAQYERR bad-bcl2l2-1 4 10 unspecified role unspecified role unspecified role unspecified role BH3 domain Region 103-127 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction bcl2l2-1 5 9 unspecified role unspecified role unspecified role unspecified role Q92843:p.[Gln88Arg;Gly89Asp;Pro91Val;Leu96Ile] Q88R/G89D/P91V/L96I mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L I certain certain sequence position certain certain certain sequence position certain P V certain certain sequence position certain certain certain sequence position certain G D certain certain sequence position certain certain certain sequence position certain Q R This feature has been corrected as a result of our quality control procedures. The original label was 'Q88R/G89D/P91V/L96I'. Wed May 02 18:28:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln88arg,gly89asp,pro91val,leu96ile' Tue Jun 30 16:20:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln88Arg;Gly89Asp;Pro91Val;Leu96Ile]' Q92843:p.Cys29Ser C29S mutation mutation certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C29S'. Wed May 02 19:27:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys29ser' Tue Jun 30 16:39:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys29Ser' ecolx Escherichia coli direct interaction direct interaction bcl2l2-puma-1 1 11 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction bcl2l2-4 3 9 unspecified role unspecified role unspecified role unspecified role Q92843:p.Cys29Ser C29S mutation mutation certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C29S'. Wed May 02 17:40:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys29ser' Tue Jun 30 18:40:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys29Ser' ecolx Escherichia coli direct interaction direct interaction bcl2l2-bim-1 2 8 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction bcl2l2-5 7 9 unspecified role unspecified role unspecified role unspecified role Q92843:p.Cys29Ser C29S mutation mutation certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C29S'. Wed May 02 19:14:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys29ser' Tue Jun 30 17:56:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys29Ser' ecolx Escherichia coli direct interaction direct interaction bcl2l2-bim-2 6 8 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction