DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Nature structural & molecular biology 2011 imex curation Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. Only protein-protein interactions in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. DIP original experiment: DIP-220356X Nature structural & molecular biology 2011 IMEx Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Nature structural & molecular biology 2011 imex curation Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. DIP original experiment: DIP-220353X Nature structural & molecular biology 2011 IMEx Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Nature structural & molecular biology 2011 imex curation Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. DIP original experiment: DIP-220355X Nature structural & molecular biology 2011 IMEx Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Nature structural & molecular biology 2011 imex curation Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper dls dynamic light scattering dls predetermined predetermined participant predetermined Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. DIP original experiment: DIP-220354X Nature structural & molecular biology 2011 IMEx Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Nature structural & molecular biology 2011 imex curation Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. DIP original experiment: DIP-220357X Nature structural & molecular biology 2011 IMEx Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Nature structural & molecular biology 2011 imex curation Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. Only protein-protein interactions in vitro In vitro alpha-screen amplified luminescent proximity homogeneous assay AlphaScreen alpha-screen AlphaScreen predetermined predetermined participant predetermined Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. DIP original experiment: DIP-220358X Nature structural & molecular biology 2011 IMEx Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. lrp6_human Low-density lipoprotein receptor-related protein 6 LRP6 protein protein human Homo sapiens Human MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS DIP protein O75581 original sequence version: 116 DIP protein O75581 original sequence version: 95 DIP protein O75581 original sequence version: 131 DIP protein O75581 original sequence version: 112 DIP protein O75581 original sequence version: 136 DIP protein O75581 original sequence version: 59 DIP protein O75581 original sequence version: 103 DIP protein O75581 original sequence version: 100 413D2CF70A5D8B5C dkk1_human Dickkopf-related protein 1 SK DKK1 UNQ492/PRO1008 protein protein human Homo sapiens Human MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH DIP protein O94907 original sequence version: 69 DIP protein O94907 original sequence version: 98 5E878B2CCE4236BA lrp6-1 2 7 unspecified role unspecified role unspecified role unspecified role E1E4 omain Region 20-1244 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction dkk1-lrp6-7 6 8 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 183-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role E3E4 domain Region 630-1244 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain E1E2 domain Region 20-629 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction dkk1-lrp6-8 1 8 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 183-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role E3E4 domain Region 630-1244 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction lrp6-5 4 7 unspecified role unspecified role unspecified role unspecified role E1E4 omain Region 20-1244 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction dkk1-lrp6-9 5 8 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 183-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role E3E4 domain Region 630-1244 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction dkk1-lrp6-10 3 8 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 183-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role E3E4 domain Region 630-1244 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction