DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Structure (London, England : 1993) 2011 imex curation Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220084X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Structure (London, England : 1993) 2011 imex curation Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220077X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Structure (London, England : 1993) 2011 imex curation Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220072X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Structure (London, England : 1993) 2011 imex curation Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220074X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Structure (London, England : 1993) 2011 imex curation Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220079X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Structure (London, England : 1993) 2011 imex curation Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220078X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Structure (London, England : 1993) 2011 imex curation Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220075X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Structure (London, England : 1993) 2011 imex curation Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220073X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Structure (London, England : 1993) 2011 imex curation Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220083X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Structure (London, England : 1993) 2011 imex curation Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220080X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Structure (London, England : 1993) 2011 imex curation Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220081X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Structure (London, England : 1993) 2011 imex curation Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220076X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Structure (London, England : 1993) 2011 imex curation Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220082X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Structure (London, England : 1993) 2011 imex curation Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220071X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. lrp6_human Low-density lipoprotein receptor-related protein 6 LRP6 protein protein human Homo sapiens Human MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS DIP protein O75581 original sequence version: 116 DIP protein O75581 original sequence version: 95 DIP protein O75581 original sequence version: 131 DIP protein O75581 original sequence version: 112 DIP protein O75581 original sequence version: 136 DIP protein O75581 original sequence version: 59 DIP protein O75581 original sequence version: 103 DIP protein O75581 original sequence version: 100 413D2CF70A5D8B5C dkk1_human Dickkopf-related protein 1 SK DKK1 UNQ492/PRO1008 protein protein human Homo sapiens Human MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH DIP protein O94907 original sequence version: 69 DIP protein O94907 original sequence version: 98 5E878B2CCE4236BA wnt3a_human Protein Wnt-3a WNT3A protein protein human Homo sapiens Human MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK DIP protein P56704 original sequence version: 81 DIP protein P56704 original sequence version: 97 DIP protein P56704 original sequence version: 135 A317BD6D4A73920B dkk2_human Dickkopf-related protein 2 DKK2 UNQ682/PRO1316 protein protein human Homo sapiens Human MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI DIP protein Q9UBU2 original sequence version: 90 39DDA3FA8975E87F wnt9b_mouse Protein Wnt-9b Wnt9b Wnt14b Wnt15 Protein Wnt-14b Protein Wnt-15 protein protein mouse Mus musculus Mouse MRPAPALALAALCLLVLPAAAAAAAYFGLTGREVLTPFPGLGTAAAPAQAGAHLKQCDLLKLSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRQERWNCSLEGRTGLLQRGFKETAFLYAVSAAALTHALARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGPKRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDTAVKVSSATNEALGRLELWAPAKPGGPAKGLAPRPGDLVYMEDSPSFCRPSKYSPGTAGRVCSRDSSCSSLCCGRGYDTQSRMVVFSCHCQVQWCCYVECQQCAQQELVYTCKR DIP protein O35468 original sequence version: 88 mint C98D7B5F566B70F5 sost_human Sclerostin SOST UNQ2976/PRO7455/PRO7476 protein protein human Homo sapiens Human MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY DIP protein Q9BQB4 original sequence version: 92 30DBD55CE73D5BB2 lrp6-dkk1-2 14 16 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 15 unspecified role unspecified role bait bait E1 domain Region 20-325 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain E3E4 domain Region 631-1253 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction lrp6-sost-2 7 20 unspecified role unspecified role unspecified role unspecified role Region 115-121 Region 115-121 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 15 unspecified role unspecified role unspecified role unspecified role E1 domain Region 20-325 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction lrp6-dkk2-1 3 18 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 15 unspecified role unspecified role bait bait E1 domain Region 20-325 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain E3E4 domain Region 631-1253 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction dkk1-lrp6-4 12 16 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 15 unspecified role unspecified role unspecified role unspecified role E1E4 domain Region 20-1253 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction lrp6-wnt9b-1 10 19 unspecified role unspecified role prey prey Region 24-359 Region 24-359 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 15 unspecified role unspecified role bait bait E1E2 domain Region 20-631 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction dkk1-lrp6-5 2 16 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 15 unspecified role unspecified role unspecified role unspecified role E1E4 domain Region 20-1253 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction lrp6-dkk1-3 9 16 unspecified role unspecified role prey prey O94907:p.His204Glu H204E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H E This feature has been corrected as a result of our quality control procedures. The original label was 'H204E'. Wed May 02 16:16:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his204glu' Tue Jun 30 17:53:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His204Glu' O94907:p.Lys211Glu K211E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K211E'. Wed May 02 17:08:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys211glu' Tue Jun 30 16:58:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys211Glu' trini Trichoplusia ni (Cabbage looper) Cabbage looper 15 unspecified role unspecified role bait bait E3E4 domain Region 631-1253 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction lrp6-sost-3 8 20 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 15 unspecified role unspecified role bait bait E1 domain Region 20-325 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction lrp6-dkk1-4 6 16 unspecified role unspecified role prey prey O94907:p.Asn40Ala N40A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A This feature has been corrected as a result of our quality control procedures. The original label was 'N40A'. Wed May 02 16:23:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn40ala' Tue Jun 30 16:25:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn40Ala' O94907:p.Ile42Glu I42E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I E This feature has been corrected as a result of our quality control procedures. The original label was 'I42E'. Wed May 02 16:42:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile42glu' Tue Jun 30 18:04:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile42Glu' trini Trichoplusia ni (Cabbage looper) Cabbage looper 15 unspecified role unspecified role bait bait E1E2 domain Region 20-631 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction lrp6-dkk1-5 11 16 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 15 unspecified role unspecified role bait bait E1E2 domain Region 20-631 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain O75581:p.Asp98Tyr D98Y mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D Y This feature has been corrected as a result of our quality control procedures. The original label was 'D98Y'. Wed May 02 18:11:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp98tyr' Tue Jun 30 19:04:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp98Tyr' O75581:p.Arg141Met R141M mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R M This feature has been corrected as a result of our quality control procedures. The original label was 'R141M'. Wed May 02 15:56:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg141met' Tue Jun 30 17:38:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg141Met' O75581:p.Asn185Ser N185S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N S This feature has been corrected as a result of our quality control procedures. The original label was 'N185S'. Wed May 02 19:27:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn185ser' Tue Jun 30 18:33:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn185Ser' O75581:p.Ala201Val A201V mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A V This feature has been corrected as a result of our quality control procedures. The original label was 'A201V'. Wed May 02 15:46:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala201val' Tue Jun 30 16:12:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala201Val' O75581:p.Ala229Thr A229T mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A T This feature has been corrected as a result of our quality control procedures. The original label was 'A229T'. Wed May 02 18:52:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala229thr' Tue Jun 30 18:26:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala229Thr' trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction lrp6-wnt3a-3 1 17 unspecified role unspecified role prey prey Region 19-352 Region 19-352 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 15 unspecified role unspecified role bait bait E1E4 domain Region 20-1253 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction dkk1-lrp6-6 4 16 unspecified role unspecified role unspecified role unspecified role Region 38-44 Region 38-44 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 15 unspecified role unspecified role unspecified role unspecified role E1 domain Region 20-325 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction lrp6-sost-4 13 20 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 15 unspecified role unspecified role bait bait E1E2 domain Region 20-631 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain O75581:p.Asp98Tyr D98Y mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D Y This feature has been corrected as a result of our quality control procedures. The original label was 'D98Y'. Wed May 02 19:19:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp98tyr' Tue Jun 30 20:08:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp98Tyr' O75581:p.Arg141Met R141M mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R M This feature has been corrected as a result of our quality control procedures. The original label was 'R141M'. Wed May 02 15:15:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg141met' Tue Jun 30 19:58:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg141Met' O75581:p.Asn185Ser N185S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N S This feature has been corrected as a result of our quality control procedures. The original label was 'N185S'. Wed May 02 20:26:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn185ser' Tue Jun 30 16:44:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn185Ser' O75581:p.Ala201Val A201V mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A V This feature has been corrected as a result of our quality control procedures. The original label was 'A201V'. Wed May 02 17:36:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala201val' Tue Jun 30 20:19:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala201Val' O75581:p.Ala229Thr A229T mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A T This feature has been corrected as a result of our quality control procedures. The original label was 'A229T'. Wed May 02 14:57:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala229thr' Tue Jun 30 20:18:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala229Thr' trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction lrp6-sost-5 5 20 unspecified role unspecified role prey prey Q9BQB4:p.Asn117Ala N117A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A This feature has been corrected as a result of our quality control procedures. The original label was 'N117A'. Wed May 02 18:43:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn117ala' Tue Jun 30 18:20:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn117Ala' Q9BQB4:p.Ile119Glu I119E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I E This feature has been corrected as a result of our quality control procedures. The original label was 'I119E'. Wed May 02 19:56:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile119glu' Tue Jun 30 17:42:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile119Glu' trini Trichoplusia ni (Cabbage looper) Cabbage looper 15 unspecified role unspecified role bait bait E1E2 domain Region 20-631 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction