DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structure (London, England : 1993) 2011 imex curation Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik DL., Macheboeuf P., Hartlieb B., Göttlinger H., Weissenhorn W. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik DL., Macheboeuf P., Hartlieb B., Göttlinger H., Weissenhorn W. DIP original experiment: DIP-218851X Structure (London, England : 1993) 2011 IMEx Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structure (London, England : 1993) 2011 imex curation Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik DL., Macheboeuf P., Hartlieb B., Göttlinger H., Weissenhorn W. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik DL., Macheboeuf P., Hartlieb B., Göttlinger H., Weissenhorn W. DIP original experiment: DIP-218853X Structure (London, England : 1993) 2011 IMEx Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structure (London, England : 1993) 2011 imex curation Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik DL., Macheboeuf P., Hartlieb B., Göttlinger H., Weissenhorn W. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik DL., Macheboeuf P., Hartlieb B., Göttlinger H., Weissenhorn W. DIP original experiment: DIP-218856X Structure (London, England : 1993) 2011 IMEx Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structure (London, England : 1993) 2011 imex curation Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik DL., Macheboeuf P., Hartlieb B., Göttlinger H., Weissenhorn W. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik DL., Macheboeuf P., Hartlieb B., Göttlinger H., Weissenhorn W. DIP original experiment: DIP-218855X Structure (London, England : 1993) 2011 IMEx Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structure (London, England : 1993) 2011 imex curation Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik DL., Macheboeuf P., Hartlieb B., Göttlinger H., Weissenhorn W. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik DL., Macheboeuf P., Hartlieb B., Göttlinger H., Weissenhorn W. DIP original experiment: DIP-218858X Structure (London, England : 1993) 2011 IMEx Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structure (London, England : 1993) 2011 imex curation Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik DL., Macheboeuf P., Hartlieb B., Göttlinger H., Weissenhorn W. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik DL., Macheboeuf P., Hartlieb B., Göttlinger H., Weissenhorn W. DIP original experiment: DIP-218857X Structure (London, England : 1993) 2011 IMEx Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structure (London, England : 1993) 2011 imex curation Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik DL., Macheboeuf P., Hartlieb B., Göttlinger H., Weissenhorn W. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik DL., Macheboeuf P., Hartlieb B., Göttlinger H., Weissenhorn W. DIP original experiment: DIP-218854X Structure (London, England : 1993) 2011 IMEx Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structural basis for ESCRT-III CHMP3 recruitment of AMSH. Structure (London, England : 1993) 2011 imex curation Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik DL., Macheboeuf P., Hartlieb B., Göttlinger H., Weissenhorn W. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik DL., Macheboeuf P., Hartlieb B., Göttlinger H., Weissenhorn W. DIP original experiment: DIP-218852X Structure (London, England : 1993) 2011 IMEx Structural basis for ESCRT-III CHMP3 recruitment of AMSH. chm1b_human Charged multivesicular body protein 1b CHMP1B C18orf2 Chromatin-modifying protein 1b CHMP1.5 Vacuolar protein sorting-associated protein 46-2 protein protein human Homo sapiens Human MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV DIP protein Q7LBR1 original sequence version: 73 DIP protein Q7LBR1 original sequence version: 53 DIP protein Q7LBR1 original sequence version: 59 DIP protein Q7LBR1 original sequence version: 98 8071E94D20D85AB5 q9hd42-1 Charged multivesicular body protein 1a CHMP1A CHMP1 KIAA0047 PCOLN3 PRSM1 Chromatin-modifying protein 1a Vacuolar protein sorting-associated protein 46-1 protein protein human Homo sapiens Human MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN DIP protein Q9HD42-1 original sequence version: 97 DIP protein Q9HD42-1 original sequence version: 79 stabp_human STAM-binding protein AMSH STAMBP Associated molecule with the SH3 domain of STAM Endosome-associated ubiquitin isopeptidase protein protein human Homo sapiens Human MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR DIP protein O95630 original sequence version: 125 DIP protein O95630 original sequence version: 88 DIP protein O95630 original sequence version: 103 7B6E08A245BD9D43 q9y3e7-1 Charged multivesicular body protein 3 CHMP3 CGI149 NEDF VPS24 Chromatin-modifying protein 3 Neuroendocrine differentiation factor Vacuolar protein sorting-associated protein 24 CGI-149 Vps24alpha protein protein human Homo sapiens Human MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLRS DIP protein Q9Y3E7-1 original sequence version: 120 DIP protein Q9Y3E7 original sequence version: 72 DIP protein Q9Y3E7-1 original sequence version: 83 chmp1b-stambp-12 4 9 unspecified role unspecified role bait bait Region 126-199 Region 126-199 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role prey prey Region 1-206 Region 1-206 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction chmp3-stambp-13 2 11 unspecified role unspecified role prey prey Region 1-146 Region 1-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain O95630:p.Glu104Ala E104A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E104A'. Wed May 02 17:50:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu104ala' Tue Jun 30 18:06:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu104Ala' O95630:p.Lys88Ala K88A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K88A'. Wed May 02 17:42:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys88ala' Tue Jun 30 18:05:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys88Ala' ecolx Escherichia coli 12 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction chmp3-stambp-14 1 11 unspecified role unspecified role unspecified role unspecified role Region 1-146 Region 1-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 183-222 Region 183-222 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction stambp-chmp3-7 6 12 unspecified role unspecified role prey prey ecolx Escherichia coli 11 unspecified role unspecified role bait bait Region 1-146 Region 1-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O95630:p.Lys88Ala K88A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K88A'. Wed May 02 16:01:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys88ala' Tue Jun 30 20:20:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys88Ala' O95630:p.Glu104Ala E104A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E104A'. Wed May 02 16:59:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu104ala' Tue Jun 30 19:50:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu104Ala' O95630:p.Lys107Ala K107A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K107A'. Wed May 02 17:36:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys107ala' Tue Jun 30 17:32:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys107Ala' ecolx Escherichia coli direct interaction direct interaction stambp-chmp1b-7 3 9 unspecified role unspecified role prey prey Region 126-199 Region 126-199 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 11 unspecified role unspecified role bait bait Region 1-146 Region 1-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction chmp3-stambp-15 8 11 unspecified role unspecified role unspecified role unspecified role Region 1-206 Region 1-206 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 183-222 Region 183-222 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction chmp1a-stambp-2 7 10 unspecified role unspecified role bait bait Region 123-196 Region 123-196 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role prey prey Region 1-206 Region 1-206 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction chmp3-stambp-16 5 11 unspecified role unspecified role prey prey Region 1-146 Region 1-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role bait bait Region 183-222 Region 183-222 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction