DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Oligomeric structure of the chemokine CCL5/RANTES from NMR, MS, and SAXS data. Oligomeric structure of the chemokine CCL5/RANTES from NMR, MS, and SAXS data. Structure (London, England : 1993) 2011 imex curation Wang X., Watson C., Sharp JS., Handel TM., Prestegard JH. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Wang X., Watson C., Sharp JS., Handel TM., Prestegard JH. DIP original experiment: DIP-218849X Structure (London, England : 1993) 2011 IMEx Oligomeric structure of the chemokine CCL5/RANTES from NMR, MS, and SAXS data. Oligomeric structure of the chemokine CCL5/RANTES from NMR, MS, and SAXS data. Oligomeric structure of the chemokine CCL5/RANTES from NMR, MS, and SAXS data. Structure (London, England : 1993) 2011 imex curation Wang X., Watson C., Sharp JS., Handel TM., Prestegard JH. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Wang X., Watson C., Sharp JS., Handel TM., Prestegard JH. DIP original experiment: DIP-218847X Structure (London, England : 1993) 2011 IMEx Oligomeric structure of the chemokine CCL5/RANTES from NMR, MS, and SAXS data. Oligomeric structure of the chemokine CCL5/RANTES from NMR, MS, and SAXS data. Oligomeric structure of the chemokine CCL5/RANTES from NMR, MS, and SAXS data. Structure (London, England : 1993) 2011 imex curation Wang X., Watson C., Sharp JS., Handel TM., Prestegard JH. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Wang X., Watson C., Sharp JS., Handel TM., Prestegard JH. DIP original experiment: DIP-218848X Structure (London, England : 1993) 2011 IMEx Oligomeric structure of the chemokine CCL5/RANTES from NMR, MS, and SAXS data. Oligomeric structure of the chemokine CCL5/RANTES from NMR, MS, and SAXS data. Oligomeric structure of the chemokine CCL5/RANTES from NMR, MS, and SAXS data. Structure (London, England : 1993) 2011 imex curation Wang X., Watson C., Sharp JS., Handel TM., Prestegard JH. Only protein-protein interactions in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Wang X., Watson C., Sharp JS., Handel TM., Prestegard JH. DIP original experiment: DIP-218850X Structure (London, England : 1993) 2011 IMEx Oligomeric structure of the chemokine CCL5/RANTES from NMR, MS, and SAXS data. ccl5_human C-C motif chemokine 5 CCL5 D17S136E SCYA5 EoCP Eosinophil chemotactic cytokine SIS-delta Small-inducible cytokine A5 T cell-specific protein P228 T-cell-specific protein RANTES protein protein human Homo sapiens Human MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS DIP protein P13501 original sequence version: 123 DIP protein P13501 original sequence version: 133 DIP protein P13501 original sequence version: 170 FB0BFAF9A87C620F ccl5-2 4 5 unspecified role unspecified role unspecified role unspecified role Mature protein Region 24-91 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ccl5-3 2 5 unspecified role unspecified role unspecified role unspecified role Mature protein Region 24-91 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ccl5-4 3 5 unspecified role unspecified role unspecified role unspecified role Mature protein Region 24-91 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ccl5-5 1 5 unspecified role unspecified role unspecified role unspecified role Mature protein Region 24-91 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction