DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Baek GH., Kim I., Rao H. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Baek GH., Kim I., Rao H. DIP original experiment: DIP-253884X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Baek GH., Kim I., Rao H. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Baek GH., Kim I., Rao H. DIP original experiment: DIP-253886X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Baek GH., Kim I., Rao H. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Baek GH., Kim I., Rao H. DIP original experiment: DIP-253892X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Baek GH., Kim I., Rao H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Baek GH., Kim I., Rao H. DIP original experiment: DIP-253882X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Baek GH., Kim I., Rao H. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Baek GH., Kim I., Rao H. DIP original experiment: DIP-253883X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Baek GH., Kim I., Rao H. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Baek GH., Kim I., Rao H. DIP original experiment: DIP-253893X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Baek GH., Kim I., Rao H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Baek GH., Kim I., Rao H. DIP original experiment: DIP-253888X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Baek GH., Kim I., Rao H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Baek GH., Kim I., Rao H. DIP original experiment: DIP-253881X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Baek GH., Kim I., Rao H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Baek GH., Kim I., Rao H. DIP original experiment: DIP-253887X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Baek GH., Kim I., Rao H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Baek GH., Kim I., Rao H. DIP original experiment: DIP-253889X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Baek GH., Kim I., Rao H. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Baek GH., Kim I., Rao H. DIP original experiment: DIP-253890X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Baek GH., Kim I., Rao H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Baek GH., Kim I., Rao H. DIP original experiment: DIP-253885X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Baek GH., Kim I., Rao H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Baek GH., Kim I., Rao H. DIP original experiment: DIP-253891X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Cdc48 ATPase modulates the interaction between two proteolytic factors Ufd2 and Rad23. ufd2_yeast E4 ubiquitin-protein ligase UFD2 UFD2 YDL190C D1255 Ubiquitin fusion degradation protein 2 Ubiquitin conjugation factor E4 RING-type E3 ubiquitin transferase UFD2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTAIEDILQITTDPSDTRGYSLLKSEEVPQGSTLGVDFIDTLLLYQLTENEKLDKPFEYLNDCFRRNQQQKRITKNKPNAESLHSTFQEIDRLVIGYGVVALQIENFCMNGAFINYITGIVSNVNSYTDFLSQIIQRAILEGTALDLLNAVFPTLLEYCNKHVSHFDLNESVIYNNVLTIFELFVTFKPIAEIFTKIDGFFADYSCKPQDFERKTILGPILSLSPIEAAVAIRNYGDNLLRSKQQTAMIHESLQAEHKVVIDRLFFIVDKLVRGSLNSRTDMISYFAHIANKNHLRRADHPPFKELSSNGFMSNITLLLVRFSQPFLDISYKKIDKIDANYFNNPSLFIDLSGETRLNSDFKEADAFYDKNRKTADSKPNFISDCFFLTLTYLHYGLGGTLSFEEKMGSEIKALKEEIEKVKKIAANHDVFARFITAQLSKMEKALKTTESLRFALQGFFAHRSLQLEVFDFICGASTFLIRVVDPEHEFPFKQIKLPLIPDQIGVENVDNADFLRAHAPVPFKYYPEFVVEGPVNYSLYISKYQTSPIFRNPRLGSFVEFTTMVLRCPELVSNPHLKGKLVQLLSVGAMPLTDNSPGFMMDIFEHDELVNKNLLYALLDFYVIVEKTGSSSQFYDKFNSRYSISIILEELYYKIPSYKNQLIWQSQNNADFFVRFVARMLNDLTFLLDEGLSNLAEVHNIQNELDNRARGAPPTREEEDKELQTRLASASRQAKSSCGLADKSMKLFEIYSKDIPAAFVTPEIVYRLASMLNYNLESLVGPKCGELKVKDPQSYSFNPKDLLKALTTVYINLSEQSEFISAVAKDERSFNRNLFVRAVDILGRKTGLASPEFIEKLLNFANKAEEQRKADEEEDLEYGDVPDEFLDPLMYTIMKDPVILPASKMNIDRSTIKAHLLSDSTDPFNRMPLKLEDVTPNEELRQKILCFKKQKKEEAKHKASE 877ACB59AC29634A 877ACB59AC29634A ufd1_yeast Ubiquitin fusion degradation protein 1 UFD1 PIP3 Polymerase-interacting protein 3 YGR048W protein protein yeast Saccharomyces cerevisiae Baker's yeast MFSGFSSFGGGNGFVNMPQTFEEFFRCYPIAMMNDRIRKDDANFGGKIFLPPSALSKLSMLNIRYPMLFKLTANETGRVTHGGVLEFIAEEGRVYLPQWMMETLGIQPGSLLQISSTDVPLGQFVKLEPQSVDFLDISDPKAVLENVLRNFSTLTVDDVIEISYNGKTFKIKILEVKPESSSKSICVIETDLVTDFAPPVGYVEPDYKALKAQQDKEKKNSFGKGQVLDPSVLGQGSMSTRIDYAGIANSSRNKLSKFVGQGQNISGKAPKAEPKQDIKDMKITFDGEPAKLDLPEGQLFFGFPMVLPKEDEESAAGSKSSEQNFQGQGISLRKSNKRKTKSDHDSSKSKAPKSPEVIEID 198E0CD48B863B98 198E0CD48B863B98 rad23_yeast UV excision repair protein RAD23 SYGP-ORF29 YEL037C RAD23 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKSTKTKVTEPPIAPESATTPGRENSTEASPSTDASAAPAATAPEGSQPQEEQTATTERTESASTPGFVVGTERNETIERIMEMGYQREEVERALRAAFNNPDRAVEYLLMGIPENLRQPEPQQQTAAAAEQPSTAATTAEQPAEDDLFAQAAQGGNASSGALGTTGGATDAAQGGPPGSIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAVGDNMQDVMEGADDMVEGEDIEVTGEAAAAGLGQGEGEGSFQVDYTPEDDQAISRLCELGFERDLVIQVYFACDKNEEAAANILFSDHAD B3F0436DAB60B833 B3F0436DAB60B833 cdc48_yeast Cell division control protein 48 CDC48 Cell division cycle protein 48 Transitional endoplasmic reticulum ATPase homolog YDL126C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGEEHKPLLDASGVDPREEDKTATAILRRKKKDNMLLVDDAINDDNSVIAINSNTMDKLELFRGDTVLVKGKKRKDTVLIVLIDDELEDGACRINRVVRNNLRIRLGDLVTIHPCPDIKYATRISVLPIADTIEGITGNLFDVFLKPYFVEAYRPVRKGDHFVVRGGMRQVEFKVVDVEPEEYAVVAQDTIIHWEGEPINREDEENNMNEVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVANETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREKMDLIDLDEDEIDAEVLDSLGVTMDNFRFALGNSNPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDELDSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRLDQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAIKDSIEAHRQHEAEKEVKVEGEDVEMTDEGAKAEQEPEVDPVPYITKEHFAEAMKTAKRSVSDAELRRYEAYSQQMKASRGQFSNFNFNDAPLGTTATDNANSNNSAPSGAGAAFGSNAEEDDDLYS 02ADDB9A227614D8 02ADDB9A227614D8 ubiq_yeast Ubiquitin UBI1 RPL40A YIL148W UBI2 RPL40B YKR094C UBI3 RPS31 YLR167W L9470.14 UBI4 SCD2 YLL039C protein protein yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG obsolete protein 9AC936269D38403E prs6a_yeast 26S proteasome regulatory subunit 6A RPT5 YTA1 YOR117W O3258 YOR3258W Tat-binding protein homolog 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MATLEELDAQTLPGDDELDQEILNLSTQELQTRAKLLDNEIRIFRSELQRLSHENNVMLEKIKDNKEKIKNNRQLPYLVANVVEVMDMNEIEDKENSESTTQGGNVNLDNTAVGKAAVVKTSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQARKSKSVSFYA C215422033FCE830 C215422033FCE830 ufd2-cdc48-8 8 17 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role bait bait P54860:p.Gly274Asp G274D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G D This feature has been corrected as a result of our quality control procedures. The original label was 'G274D'. Wed May 02 20:21:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly274asp' Tue Jun 30 16:40:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly274Asp' P54860:p.Cys385Tyr C385Y mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain C Y This feature has been corrected as a result of our quality control procedures. The original label was 'C385Y'. Wed May 02 17:36:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys385tyr' Tue Jun 30 17:03:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys385Tyr' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ub-ub-1 12 18 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait beta-gal-tag beta-gal-tag fusion protein fusion protein c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rad23-ufd2-2 6 14 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association cdc48-ufd1-5 10 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ufd2-rad23-1 4 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rad23-rpt5-3 2 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association cdc48-ufd1-6 11 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ufd2-cdc48-9 5 17 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 14 unspecified role unspecified role bait bait P54860:p.Gly274Asp G274D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G D This feature has been corrected as a result of our quality control procedures. The original label was 'G274D'. Wed May 02 15:52:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly274asp' Tue Jun 30 18:49:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly274Asp' P54860:p.Cys385Tyr C385Y mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain C Y This feature has been corrected as a result of our quality control procedures. The original label was 'C385Y'. Wed May 02 15:44:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys385tyr' Tue Jun 30 19:04:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys385Tyr' Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction rad23-ufd2-3 9 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rad23-cdc48-1 13 17 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rad23-ufd2-4 1 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 14 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction ufd2-cdc48-10 7 17 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role bait bait P54860:p.Gly274Asp G274D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G D This feature has been corrected as a result of our quality control procedures. The original label was 'G274D'. Wed May 02 19:41:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly274asp' Tue Jun 30 18:41:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly274Asp' P54860:p.Cys385Tyr C385Y mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain C Y This feature has been corrected as a result of our quality control procedures. The original label was 'C385Y'. Wed May 02 15:33:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys385tyr' Tue Jun 30 16:54:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys385Tyr' Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdc48-rad23-1 3 14 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 17 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 16 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli association association