DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly. Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Zeytuni N., Ozyamak E., Ben-Harush K., Davidov G., Levin M., Gat Y., Moyal T., Brik A., Komeili A., Zarivach R. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Zeytuni N., Ozyamak E., Ben-Harush K., Davidov G., Levin M., Gat Y., Moyal T., Brik A., Komeili A., Zarivach R. DIP original experiment: DIP-253879X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly. Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly. Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Zeytuni N., Ozyamak E., Ben-Harush K., Davidov G., Levin M., Gat Y., Moyal T., Brik A., Komeili A., Zarivach R. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zeytuni N., Ozyamak E., Ben-Harush K., Davidov G., Levin M., Gat Y., Moyal T., Brik A., Komeili A., Zarivach R. DIP original experiment: DIP-253876X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly. Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly. Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Zeytuni N., Ozyamak E., Ben-Harush K., Davidov G., Levin M., Gat Y., Moyal T., Brik A., Komeili A., Zarivach R. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Zeytuni N., Ozyamak E., Ben-Harush K., Davidov G., Levin M., Gat Y., Moyal T., Brik A., Komeili A., Zarivach R. DIP original experiment: DIP-253877X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly. Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly. Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Zeytuni N., Ozyamak E., Ben-Harush K., Davidov G., Levin M., Gat Y., Moyal T., Brik A., Komeili A., Zarivach R. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zeytuni N., Ozyamak E., Ben-Harush K., Davidov G., Levin M., Gat Y., Moyal T., Brik A., Komeili A., Zarivach R. DIP original experiment: DIP-253878X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly. Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly. Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Zeytuni N., Ozyamak E., Ben-Harush K., Davidov G., Levin M., Gat Y., Moyal T., Brik A., Komeili A., Zarivach R. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Zeytuni N., Ozyamak E., Ben-Harush K., Davidov G., Levin M., Gat Y., Moyal T., Brik A., Komeili A., Zarivach R. DIP original experiment: DIP-253880X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly. mama_magmg Magnetosome protein MamA mamA mam22 protein protein magmg Magnetospirillum magnetotacticum Aquaspirillum magnetotacticum MSSKPSDILDEVTLYAHYGLSVAKKLGMNMVDAFRAAFSVNDDIRQVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASV DIP protein Q50224 original sequence version: 46 DIP protein Q50224 original sequence version: 53 mama_maggm Magnetosome protein MamA MM24.3 MGR_4099 mgI495 MGMSRv2__2371 mamA protein protein MAGGM Magnetospirillum gryphiswaldense (strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1) MSSKPSNMLDEVTLYTHYGLSVAKKLGANMVDAFRSAFSVNDDIRQVYYRDKGISHAKAGRYSEAVVMLEQVYDADAFDVEVALHLGIAYVKTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERSAV DIP protein Q93DY9 original sequence version: 57 mama-1 1 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mam22-3 2 6 unspecified role unspecified role unspecified role unspecified role Region 1-40 Region 1-40 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P0DO20:p.Arg50Glu R50E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R50E'. Wed May 02 18:14:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg50glu' Tue Jun 30 17:42:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg50Glu' ecolx Escherichia coli direct interaction direct interaction mam22-mam22-2 5 6 unspecified role unspecified role unspecified role unspecified role Region 11-23 Region 11-23 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 6 unspecified role unspecified role unspecified role unspecified role Region 41-217 Region 41-217 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mam22-4 3 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mama-2 4 7 unspecified role unspecified role unspecified role unspecified role Region 1-40 Region 1-40 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q93DY9:p.Arg50Glu R50E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R50E'. Wed May 02 16:22:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg50glu' Tue Jun 30 19:11:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg50Glu' ecolx Escherichia coli direct interaction direct interaction