DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Nature structural & molecular biology 2011 imex curation Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. DIP original experiment: DIP-218662X Nature structural & molecular biology 2011 IMEx Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Nature structural & molecular biology 2011 imex curation Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. Only protein-protein interactions ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. DIP original experiment: DIP-218660X Nature structural & molecular biology 2011 IMEx Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Nature structural & molecular biology 2011 imex curation Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. DIP original experiment: DIP-218658X Nature structural & molecular biology 2011 IMEx Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Nature structural & molecular biology 2011 imex curation Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. DIP original experiment: DIP-218663X Nature structural & molecular biology 2011 IMEx Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Nature structural & molecular biology 2011 imex curation Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. DIP original experiment: DIP-218659X Nature structural & molecular biology 2011 IMEx Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Nature structural & molecular biology 2011 imex curation Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. Only protein-protein interactions ecolx Escherichia coli anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. DIP original experiment: DIP-218661X Nature structural & molecular biology 2011 IMEx Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Nature structural & molecular biology 2011 imex curation Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. DIP original experiment: DIP-218657X Nature structural & molecular biology 2011 IMEx Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. rbl_synp6 Ribulose bisphosphate carboxylase large chain cbbL rbcA rbcL syc0130_c protein protein anacystis nidulans Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) Anacystis nidulans MPKTQSAAGYKAGVKDYKLTYYTPDYTPKDTDLLAAFRFSPQPGVPADEAGAAIAAESSTGTWTTVWTDLLTDMDRYKGKCYHIEPVQGEENSYFAFIAYPLDLFEEGSVTNILTSIVGNVFGFKAIRSLRLEDIRFPVALVKTFQGPPHGIQVERDLLNKYGRPMLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFLFVADAIHKSQAETGEIKGHYLNVTAPTCEEMMKRAEFAKELGMPIIMHDFLTAGFTANTTLAKWCRDNGVLLHIHRAMHAVIDRQRNHGIHFRVLAKCLRLSGGDHLHSGTVVGKLEGDKASTLGFVDLMREDHIEADRSRGVFFTQDWASMPGVLPVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATANRVALEACVQARNEGRDLYREGGDILREAGKWSPELAAALDLWKEIKFEFETMDKL DIP protein P00880 original sequence version: 96 CDD8519AA9D493C9 rbcx_synp6 RuBisCO chaperone RbcX rbcX syc2521_d protein protein anacystis nidulans Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) Anacystis nidulans MQFMGTASRMASTQRAKPMEMPRISRDTARMLVNYLTYQAVCVIRDQLAETNPAGAYRLQVFSAEFSFQDGEAYLAALLNHDRELGLRVMTVREHLAEHILDYLPEMTIAQIQEANINHRRALLERLTGLGAEPSLPETEVSDRPSDSATPDDASNASHAD rbcx_anasc RuBisCO chaperone RbcX rbcX protein protein anasc Anabaena sp. (strain CA / ATCC 33047) MNLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLALWLHNFSAGKVQDGEKYIEELFLEKPDLALRIMTVREHIAEEIAEFLPEMVVTGIQQANMEKRRQHLERMTQVSLSHPSPESEQQQFSDPDWDNLAS DIP protein Q44212 original sequence version: 28 5CE932C99D632FEC cbbl-rbcx-1 7 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cbbl-syn6301rbcx-1 1 9 unspecified role unspecified role unspecified role unspecified role A0A0H3K9R3:p.Thr51Cys T51C mutation mutation certain certain sequence position certain certain certain sequence position certain T C Wed May 02 20:28:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr51cys' Tue Jun 30 19:40:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr51Cys' ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role P00880:p.Glu49Cys E49C mutation mutation certain certain sequence position certain certain certain sequence position certain E C This feature has been corrected as a result of our quality control procedures. The original label was 'E49C'. Wed May 02 14:36:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu49cys' Tue Jun 30 16:18:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu49Cys' ecolx Escherichia coli direct interaction direct interaction cbbl-1 2 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction rbcx-cbbl-1 3 10 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association syn6301rbcx-cbbl-1 6 9 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association cbbl-rbcx-2 4 10 unspecified role unspecified role unspecified role unspecified role Q44212:p.Thr33Cys T33C mutation mutation certain certain sequence position certain certain certain sequence position certain T C This feature has been corrected as a result of our quality control procedures. The original label was 'T33C'. Wed May 02 17:49:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr33cys' Tue Jun 30 17:49:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr33Cys' ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role P00880:p.Glu49Cys E49C mutation mutation certain certain sequence position certain certain certain sequence position certain E C This feature has been corrected as a result of our quality control procedures. The original label was 'E49C'. Wed May 02 14:50:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu49cys' Tue Jun 30 17:13:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu49Cys' ecolx Escherichia coli direct interaction direct interaction syn6301rbcx-cbbl-2 5 9 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association