DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Sawa M., Kay SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sawa M., Kay SA. DIP original experiment: DIP-249620X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Sawa M., Kay SA. Only protein-protein interactions nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sawa M., Kay SA. DIP original experiment: DIP-249615X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Sawa M., Kay SA. Only protein-protein interactions nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sawa M., Kay SA. DIP original experiment: DIP-249614X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Sawa M., Kay SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sawa M., Kay SA. DIP original experiment: DIP-249618X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Sawa M., Kay SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sawa M., Kay SA. DIP original experiment: DIP-249617X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Sawa M., Kay SA. Only protein-protein interactions nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sawa M., Kay SA. DIP original experiment: DIP-249616X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Sawa M., Kay SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sawa M., Kay SA. DIP original experiment: DIP-249619X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana. svp_arath MADS-box protein SVP Protein SHORT VEGETATIVE PHASE SVP F14M13.6 At2g22540 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSSSMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLDIEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRLRQQGTQLTEENERLGMQICNNVHAHGGAESENAAVYEEGQSSESITNAGNSTGAPVDSESSDTSLRLGLPYGG DIP protein Q9FVC1 original sequence version: 83 DIP protein Q9FVC1 original sequence version: 104 C14F3B6A259DF26E flc_arath MADS-box protein FLOWERING LOCUS C FLC FLF MADS-box protein FLOWERING LOCUS F T31P16.130 At5g10140 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRKKLEIKRIENKSSRQVTFSKRRNGLIEKARQLSVLCDASVALLVVSASGKLYSFSSGDNLVKILDRYGKQHADDLKALDHQSKALNYGSHYELLELVDSKLVGSNVKNVSIDALVQLEEHLETALSVTRAKKTELMLKLVENLKEKEKMLKEENQVLASQMENNHHVGAEAEMEMSPAGQISDNLPVTLPLLN DIP protein Q9S7Q7 original sequence version: 93 DIP protein Q9S7Q7 original sequence version: 106 656085A2B157FF42 ravl1_arath AP2/ERF and B3 domain-containing transcription repressor TEM1 TEM1 Protein TEMPRANILLO 1 RAV1-like ethylene-responsive transcription factor TEM1 F2J7.3 At1g25560 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEYSCVDDSSTTSESLSISTTPKPTTTTEKKLSSPPATSMRLYRMGSGGSSVVLDSENGVETESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAASSYDIAVRRFRGRDAVTNFKSQVDGNDAESAFLDAHSKAEIVDMLRKHTYADEFEQSRRKFVNGDGKRSGLETATYGNDAVLRAREVLFEKTVTPSDVGKLNRLVIPKQHAEKHFPLPAMTTAMGMNPSPTKGVLINLEDRTGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVCFERSTGPDRQLYIHWKVRSSPVQTVVRLFGVNIFNVSNEKPNDVAVECVGKKRSREDDLFSLGCSKKQAIINIL DIP protein Q9C6M5 original sequence version: 77 52DB2D42DAD3042B gigan_arath Protein GIGANTEA GI At1g22770 T22J18.6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTERNCLSKATTSGSPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIASRGSGKHPQLMPSTPRWAVANGAGVILSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATPSATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIAMSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAEATIEATAQGIASMLCAHGPEVEWRICTIWEAAYGLIPLNSSAVDLPEIIVATPLQPPILSWNLYIPLLKVLEYLPRGSPSEACLMKIFVATVETILSRTFPPESSRELTRKARSSFTTRSATKNLAMSELRAMVHALFLESCAGVELASRLLFVVLTVCVSHEAQSSGSKRPRSEYASTTENIEANQPVSNNQTANRKSRNVKGQGPVAAFDSYVLAAVCALACEVQLYPMISGGGNFSNSAVAGTITKPVKINGSSKEYGAGIDSAISHTRRILAILEALFSLKPSSVGTPWSYSSSEIVAAAMVAAHISELFRRSKALTHALSGLMRCKWDKEIHKRASSLYNLIDVHSKVVASIVDKAEPLEAYLKNTPVQKDSVTCLNWKQENTCASTTCFDTAVTSASRTEMNPRGNHKYARHSDEGSGRPSEKGIKDFLLDASDLANFLTADRLAGFYCGTQKLLRSVLAEKPELSFSVVSLLWHKLIAAPEIQPTAESTSAQQGWRQVVDALCNVVSATPAKAAAAVVLQAERELQPWIAKDDEEGQKMWKINQRIVKVLVELMRNHDRPESLVILASASDLLLRATDGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHPSAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFNAASIDWKADIQNCLNWEAHSLLSTTMPTQFLDTAARELGCTISLSQ DIP protein Q9SQI2 original sequence version: 85 DIP protein Q9SQI2 original sequence version: 78 71CFDE7D39E73549 rav2_arath AP2/ERF and B3 domain-containing transcription repressor RAV2 RAV2 Ethylene-responsive transcription factor RAV2 Protein RELATED TO ABI3/VP1 2 Protein RELATED TO APETALA2 8 Protein TEMPRANILLO 2 RAP2-8 TEM2 F14K14.5 T6L1.3 At1g68840 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDSSCIDEISSSTSESFSATTAKKLSPPPAAALRLYRMGSGGSSVVLDPENGLETESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEQEEAARSYDIAACRFRGRDAVVNFKNVLEDGDLAFLEAHSKAEIVDMLRKHTYADELEQNNKRQLFLSVDANGKRNGSSTTQNDKVLKTREVLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLPSPSPAVTKGVLINFEDVNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVTFERSTGLERQLYIDWKVRSGPRENPVQVVVRLFGVDIFNVTTVKPNDVVAVCGGKRSRDVDDMFALRCSKKQAIINAL DIP protein P82280 original sequence version: 84 D130DA8DA99ACC75 rav2-gi-1 6 12 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 11 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana physical association physical association svp-gi-1 3 8 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 11 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana physical association physical association tem1-gi-1 4 10 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role prey prey N-terminal domain Region 1-391 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rav2-gi-2 7 12 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role prey prey N-terminal domain Region 1-391 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction svp-gi-2 5 8 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role prey prey N-terminal domain Region 1-391 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tem1-gi-2 2 10 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 11 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana physical association physical association flc-gi-1 1 9 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role prey prey N-terminal domain Region 1-391 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction