DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Systems analysis identifies an essential role for SHANK-associated RH domain-interacting protein (SHARPIN) in macrophage Toll-like receptor 2 (TLR2) responses. Systems analysis identifies an essential role for SHANK-associated RH domain-interacting protein (SHARPIN) in macrophage Toll-like receptor 2 (TLR2) responses. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Zak DE., Schmitz F., Gold ES., Diercks AH., Peschon JJ., Valvo JS., Niemistö A., Podolsky I., Fallen SG., Suen R., Stolyar T., Johnson CD., Kennedy KA., Hamilton MK., Siggs OM., Beutler B., Aderem A. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zak DE., Schmitz F., Gold ES., Diercks AH., Peschon JJ., Valvo JS., Niemistö A., Podolsky I., Fallen SG., Suen R., Stolyar T., Johnson CD., Kennedy KA., Hamilton MK., Siggs OM., Beutler B., Aderem A. DIP original experiment: DIP-253938X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Systems analysis identifies an essential role for SHANK-associated RH domain-interacting protein (SHARPIN) in macrophage Toll-like receptor 2 (TLR2) responses. Systems analysis identifies an essential role for SHANK-associated RH domain-interacting protein (SHARPIN) in macrophage Toll-like receptor 2 (TLR2) responses. Systems analysis identifies an essential role for SHANK-associated RH domain-interacting protein (SHARPIN) in macrophage Toll-like receptor 2 (TLR2) responses. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Zak DE., Schmitz F., Gold ES., Diercks AH., Peschon JJ., Valvo JS., Niemistö A., Podolsky I., Fallen SG., Suen R., Stolyar T., Johnson CD., Kennedy KA., Hamilton MK., Siggs OM., Beutler B., Aderem A. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zak DE., Schmitz F., Gold ES., Diercks AH., Peschon JJ., Valvo JS., Niemistö A., Podolsky I., Fallen SG., Suen R., Stolyar T., Johnson CD., Kennedy KA., Hamilton MK., Siggs OM., Beutler B., Aderem A. DIP original experiment: DIP-253940X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Systems analysis identifies an essential role for SHANK-associated RH domain-interacting protein (SHARPIN) in macrophage Toll-like receptor 2 (TLR2) responses. Systems analysis identifies an essential role for SHANK-associated RH domain-interacting protein (SHARPIN) in macrophage Toll-like receptor 2 (TLR2) responses. Systems analysis identifies an essential role for SHANK-associated RH domain-interacting protein (SHARPIN) in macrophage Toll-like receptor 2 (TLR2) responses. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Zak DE., Schmitz F., Gold ES., Diercks AH., Peschon JJ., Valvo JS., Niemistö A., Podolsky I., Fallen SG., Suen R., Stolyar T., Johnson CD., Kennedy KA., Hamilton MK., Siggs OM., Beutler B., Aderem A. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zak DE., Schmitz F., Gold ES., Diercks AH., Peschon JJ., Valvo JS., Niemistö A., Podolsky I., Fallen SG., Suen R., Stolyar T., Johnson CD., Kennedy KA., Hamilton MK., Siggs OM., Beutler B., Aderem A. DIP original experiment: DIP-253937X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Systems analysis identifies an essential role for SHANK-associated RH domain-interacting protein (SHARPIN) in macrophage Toll-like receptor 2 (TLR2) responses. Systems analysis identifies an essential role for SHANK-associated RH domain-interacting protein (SHARPIN) in macrophage Toll-like receptor 2 (TLR2) responses. Systems analysis identifies an essential role for SHANK-associated RH domain-interacting protein (SHARPIN) in macrophage Toll-like receptor 2 (TLR2) responses. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Zak DE., Schmitz F., Gold ES., Diercks AH., Peschon JJ., Valvo JS., Niemistö A., Podolsky I., Fallen SG., Suen R., Stolyar T., Johnson CD., Kennedy KA., Hamilton MK., Siggs OM., Beutler B., Aderem A. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zak DE., Schmitz F., Gold ES., Diercks AH., Peschon JJ., Valvo JS., Niemistö A., Podolsky I., Fallen SG., Suen R., Stolyar T., Johnson CD., Kennedy KA., Hamilton MK., Siggs OM., Beutler B., Aderem A. DIP original experiment: DIP-253939X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Systems analysis identifies an essential role for SHANK-associated RH domain-interacting protein (SHARPIN) in macrophage Toll-like receptor 2 (TLR2) responses. shrpn_human Sharpin SHARPIN SIPL1 Shank-associated RH domain-interacting protein Shank-interacting protein-like 1 PSEC0216 protein protein human Homo sapiens Human MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNGSKSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQEACFPPGPIRLQVTLEDAASAASAASSAHVALQVHPHCTVAALQEQVFSELGFPPAVQRWVIGRCLCVPERSLASYGVRQDGDPAFLYLLSAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQPSWSCPSCTFINAPDRPGCEMCSTQRPCTWDPLAAAST DIP protein Q9H0F6 original sequence version: 80 DIP protein Q9H0F6 original sequence version: 89 DIP protein Q9H0F6-1 original sequence version: 68 DIP protein Q9H0F6 original sequence version: 68 DIP protein Q9H0F6-1 original sequence version: 72 DIP protein Q9H0F6 original sequence version: 91 33EE4BF66936AB60 hoil1_human RanBP-type and C3HC4-type zinc finger-containing protein 1 RBCK1 C20orf18 RNF54 UBCE7IP3 XAP3 XAP4 Ubiquitin-conjugating enzyme 7-interacting protein 3 Hepatitis B virus X-associated protein 4 HBV-associated factor 4 RING finger protein 54 Heme-oxidized IRP2 ubiquitin ligase 1 RING-type E3 ubiquitin transferase HOIL-1 protein protein human Homo sapiens Human MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH DIP protein Q9BYM8 original sequence version: 114 DIP protein Q9BYM8 original sequence version: 124 DIP protein Q9BYM8-1 original sequence version: 102 DIP protein Q9BYM8 original sequence version: 102 DIP protein Q9BYM8-1 original sequence version: 107 DIP protein Q9BYM8-1 original sequence version: 126 C6EF957B1F152FF2 nemo_human NF-kappa-B essential modulator IKBKG FIP3 NEMO NF-kappa-B essential modifier Inhibitor of nuclear factor kappa-B kinase subunit gamma IkB kinase-associated protein 1 FIP-3 protein protein human Homo sapiens Human MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE DIP protein Q9Y6K9 original sequence version: 85 DIP protein Q9Y6K9 original sequence version: 118 DIP protein Q9Y6K9 original sequence version: 123 DIP protein Q9Y6K9 original sequence version: 141 DIP protein Q9Y6K9 original sequence version: 125 DIP protein Q9Y6K9 original sequence version: 156 DIP protein Q9Y6K9 original sequence version: 83 DIP protein Q9Y6K9 original sequence version: 132 DIP protein Q9Y6K9 original sequence version: 124 DIP protein Q9Y6K9 original sequence version: 90 322D1037881447FF ikbkg-rbck1-6 3 6 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 5 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 7 unspecified role unspecified role bait bait Q9Y6K9:p.Leu153Pro L153P mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L P This feature has been corrected as a result of our quality control procedures. The original label was 'L153P'. Wed May 02 15:34:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu153pro' Tue Jun 30 19:59:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu153Pro' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association ikbkg-rbck1-7 4 6 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 7 unspecified role unspecified role bait bait Q9Y6K9:p.Leu153Pro L153P mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L P This feature has been corrected as a result of our quality control procedures. The original label was 'L153P'. Wed May 02 18:28:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu153pro' Tue Jun 30 20:22:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu153Pro' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association ikbkg-sharpin-1 1 5 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 7 unspecified role unspecified role bait bait Q9Y6K9:p.Leu153Pro L153P mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L P This feature has been corrected as a result of our quality control procedures. The original label was 'L153P'. Wed May 02 16:05:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu153pro' Tue Jun 30 18:59:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu153Pro' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association ikbkg-sharpin-2 2 5 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 7 unspecified role unspecified role bait bait Q9Y6K9:p.Leu153Pro L153P mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L P This feature has been corrected as a result of our quality control procedures. The original label was 'L153P'. Wed May 02 20:21:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu153pro' Tue Jun 30 18:18:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu153Pro' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association